Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T200

Protein Details
Accession M2T200    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-37TAPKAKKTPTDKQSKDKVVKRRARGYHBasic
NLS Segment(s)
PositionSequence
16-19KKTP
21-33DKQSKDKVVKRRA
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG bsc:COCSADRAFT_161742  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MAPQKPAANDTAPKAKKTPTDKQSKDKVVKRRARGYHTFRNGMLNVTPKGGDVKANQQSPLLRLPPEIRNMIWELVLAGRVCTLDYDKAGHVSMSSPKAPTGISLLRVCRQIYAEAANIPLQQNTSSFSTCYNIHKWFVVLNKGQRNQVTSLRFEDKLVKDFSDFVYSMTYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.46
4 0.51
5 0.56
6 0.55
7 0.64
8 0.68
9 0.75
10 0.8
11 0.81
12 0.83
13 0.8
14 0.81
15 0.8
16 0.82
17 0.82
18 0.81
19 0.79
20 0.77
21 0.8
22 0.78
23 0.78
24 0.76
25 0.71
26 0.61
27 0.59
28 0.51
29 0.43
30 0.37
31 0.31
32 0.25
33 0.23
34 0.22
35 0.17
36 0.18
37 0.17
38 0.17
39 0.15
40 0.23
41 0.28
42 0.3
43 0.3
44 0.3
45 0.3
46 0.29
47 0.31
48 0.24
49 0.18
50 0.18
51 0.22
52 0.24
53 0.26
54 0.25
55 0.21
56 0.21
57 0.22
58 0.21
59 0.17
60 0.13
61 0.1
62 0.08
63 0.1
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.07
79 0.08
80 0.11
81 0.12
82 0.13
83 0.12
84 0.12
85 0.13
86 0.13
87 0.12
88 0.13
89 0.12
90 0.15
91 0.17
92 0.19
93 0.21
94 0.23
95 0.23
96 0.19
97 0.19
98 0.16
99 0.16
100 0.16
101 0.15
102 0.13
103 0.14
104 0.14
105 0.14
106 0.13
107 0.12
108 0.11
109 0.1
110 0.1
111 0.12
112 0.13
113 0.13
114 0.13
115 0.14
116 0.16
117 0.18
118 0.22
119 0.24
120 0.25
121 0.25
122 0.26
123 0.25
124 0.26
125 0.28
126 0.3
127 0.31
128 0.36
129 0.43
130 0.46
131 0.5
132 0.49
133 0.48
134 0.45
135 0.47
136 0.43
137 0.37
138 0.4
139 0.41
140 0.39
141 0.37
142 0.42
143 0.38
144 0.4
145 0.39
146 0.34
147 0.3
148 0.31
149 0.32
150 0.29
151 0.26
152 0.21
153 0.22