Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QW69

Protein Details
Accession M2QW69   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MVEHCKRLRIQYRPNPRQSWHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.333, cyto_nucl 4.333, cyto 4
Family & Domain DBs
KEGG bsc:COCSADRAFT_164905  -  
Amino Acid Sequences MVEHCKRLRIQYRPNPRQSWHLLKNLGKLNGGLNAGIAKVSCSNSSARGMVFIEKRFGAQEFRYKVAHREIQLLHQVSDHMNVVTMVDHFLNEGALQAAIYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.75
4 0.73
5 0.71
6 0.7
7 0.65
8 0.63
9 0.61
10 0.58
11 0.63
12 0.6
13 0.53
14 0.44
15 0.38
16 0.31
17 0.28
18 0.25
19 0.18
20 0.12
21 0.1
22 0.1
23 0.09
24 0.08
25 0.05
26 0.06
27 0.07
28 0.08
29 0.09
30 0.1
31 0.12
32 0.14
33 0.13
34 0.12
35 0.12
36 0.12
37 0.14
38 0.16
39 0.15
40 0.14
41 0.14
42 0.14
43 0.14
44 0.14
45 0.13
46 0.13
47 0.2
48 0.21
49 0.24
50 0.25
51 0.25
52 0.28
53 0.32
54 0.34
55 0.28
56 0.31
57 0.3
58 0.32
59 0.38
60 0.37
61 0.3
62 0.26
63 0.26
64 0.2
65 0.21
66 0.18
67 0.1
68 0.09
69 0.09
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.07
81 0.06
82 0.06
83 0.06