Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T969

Protein Details
Accession M2T969    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-28VEPPAIKKRGRPKKAAAEDAGHydrophilic
NLS Segment(s)
PositionSequence
13-22IKKRGRPKKA
46-68TKPTAPKHKPVAPEKDKKTIAKK
Subcellular Location(s) nucl 11, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_309884  -  
Amino Acid Sequences MSSTNTTVEPPAIKKRGRPKKAAAEDAGETISVDGEKTPAVKKVTTKPTAPKHKPVAPEKDKKTIAKKNAPEHPTPVTPATSKILESVRAKGTLSKTLPTKTTSLESRNSGTPLATKPATATTAQVPPVSSSPPPPPPSKPPRTHPIPTAIPLPQKPFPAPSPIFSTSHTTSPRNPVLPPNPYPSTPRRVPPALSQHTRVIEPTPDIRLPPKYKPAARRVTAIIVSLPIVLVFGYELLERWRGKKDVKVKFGGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.57
3 0.65
4 0.69
5 0.72
6 0.72
7 0.76
8 0.82
9 0.82
10 0.74
11 0.68
12 0.61
13 0.54
14 0.45
15 0.33
16 0.24
17 0.16
18 0.13
19 0.08
20 0.07
21 0.05
22 0.06
23 0.07
24 0.09
25 0.11
26 0.16
27 0.18
28 0.21
29 0.27
30 0.36
31 0.45
32 0.48
33 0.51
34 0.55
35 0.63
36 0.72
37 0.72
38 0.72
39 0.7
40 0.71
41 0.74
42 0.73
43 0.74
44 0.72
45 0.76
46 0.72
47 0.73
48 0.72
49 0.7
50 0.71
51 0.69
52 0.69
53 0.69
54 0.71
55 0.7
56 0.74
57 0.73
58 0.65
59 0.6
60 0.55
61 0.47
62 0.42
63 0.36
64 0.29
65 0.25
66 0.25
67 0.23
68 0.19
69 0.18
70 0.18
71 0.17
72 0.21
73 0.22
74 0.24
75 0.23
76 0.23
77 0.23
78 0.24
79 0.25
80 0.27
81 0.27
82 0.26
83 0.27
84 0.29
85 0.3
86 0.28
87 0.27
88 0.21
89 0.24
90 0.24
91 0.25
92 0.26
93 0.26
94 0.27
95 0.27
96 0.26
97 0.22
98 0.18
99 0.17
100 0.15
101 0.17
102 0.14
103 0.13
104 0.12
105 0.13
106 0.15
107 0.13
108 0.13
109 0.11
110 0.14
111 0.15
112 0.14
113 0.13
114 0.13
115 0.13
116 0.13
117 0.11
118 0.12
119 0.15
120 0.2
121 0.23
122 0.25
123 0.28
124 0.36
125 0.45
126 0.52
127 0.54
128 0.53
129 0.59
130 0.63
131 0.62
132 0.56
133 0.53
134 0.46
135 0.43
136 0.4
137 0.34
138 0.31
139 0.3
140 0.32
141 0.27
142 0.27
143 0.26
144 0.26
145 0.25
146 0.29
147 0.29
148 0.26
149 0.3
150 0.31
151 0.32
152 0.3
153 0.35
154 0.29
155 0.33
156 0.35
157 0.3
158 0.3
159 0.36
160 0.39
161 0.34
162 0.34
163 0.36
164 0.39
165 0.43
166 0.43
167 0.43
168 0.41
169 0.41
170 0.45
171 0.43
172 0.44
173 0.42
174 0.42
175 0.42
176 0.43
177 0.44
178 0.47
179 0.52
180 0.53
181 0.53
182 0.53
183 0.51
184 0.5
185 0.47
186 0.4
187 0.32
188 0.26
189 0.25
190 0.24
191 0.24
192 0.23
193 0.24
194 0.27
195 0.33
196 0.36
197 0.39
198 0.45
199 0.49
200 0.55
201 0.63
202 0.69
203 0.7
204 0.68
205 0.66
206 0.6
207 0.57
208 0.51
209 0.43
210 0.34
211 0.25
212 0.23
213 0.18
214 0.14
215 0.08
216 0.07
217 0.06
218 0.05
219 0.04
220 0.04
221 0.05
222 0.05
223 0.06
224 0.09
225 0.15
226 0.16
227 0.19
228 0.26
229 0.3
230 0.34
231 0.42
232 0.5
233 0.55
234 0.61
235 0.66