Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T171

Protein Details
Accession M2T171   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-56EHLARRREQNRIAQQKHRNRKKEGREKAQSRGKKKAPTKQRTTLQKLNHydrophilic
NLS Segment(s)
PositionSequence
14-47RREQNRIAQQKHRNRKKEGREKAQSRGKKKAPTK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG bsc:COCSADRAFT_358696  -  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MLVETSAEEHLARRREQNRIAQQKHRNRKKEGREKAQSRGKKKAPTKQRTTLQKLNRTAPTQQCQYETALAGESDYSTPVQSHGDIAGQQVSNTSLSPRWSPPTMVVYTSPFEKGYKLMNEGLACECTETAGTQKDEGKQGKEKVECVNRDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.51
4 0.59
5 0.63
6 0.7
7 0.74
8 0.75
9 0.8
10 0.83
11 0.87
12 0.87
13 0.84
14 0.83
15 0.86
16 0.88
17 0.88
18 0.88
19 0.87
20 0.88
21 0.85
22 0.85
23 0.84
24 0.81
25 0.77
26 0.76
27 0.72
28 0.71
29 0.74
30 0.74
31 0.75
32 0.77
33 0.79
34 0.78
35 0.8
36 0.8
37 0.81
38 0.8
39 0.78
40 0.76
41 0.72
42 0.69
43 0.65
44 0.58
45 0.56
46 0.54
47 0.5
48 0.46
49 0.42
50 0.38
51 0.34
52 0.33
53 0.28
54 0.21
55 0.16
56 0.12
57 0.1
58 0.09
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.08
83 0.1
84 0.13
85 0.15
86 0.18
87 0.19
88 0.2
89 0.22
90 0.25
91 0.25
92 0.24
93 0.23
94 0.21
95 0.21
96 0.22
97 0.2
98 0.16
99 0.15
100 0.14
101 0.15
102 0.18
103 0.19
104 0.21
105 0.22
106 0.24
107 0.24
108 0.25
109 0.25
110 0.2
111 0.17
112 0.15
113 0.13
114 0.1
115 0.1
116 0.09
117 0.11
118 0.15
119 0.16
120 0.19
121 0.23
122 0.26
123 0.34
124 0.38
125 0.4
126 0.43
127 0.47
128 0.53
129 0.52
130 0.52
131 0.54
132 0.59