Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2RNY4

Protein Details
Accession M2RNY4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-50GVEKGHVRDRRRRCRNRDAVARFBasic
NLS Segment(s)
Subcellular Location(s) plas 11, cyto 6, mito 5, E.R. 2, extr 1, pero 1, vacu 1
Family & Domain DBs
KEGG bsc:COCSADRAFT_271785  -  
Amino Acid Sequences MIAGLSVDMRIDRSCLSGRVRSARCSGGVEKGHVRDRRRRCRNRDAVARFEARRLVRICYVLESVKNECNWRRIMGVFALSFTGIVGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.23
4 0.26
5 0.3
6 0.38
7 0.4
8 0.4
9 0.42
10 0.39
11 0.37
12 0.36
13 0.33
14 0.32
15 0.31
16 0.3
17 0.3
18 0.32
19 0.38
20 0.39
21 0.42
22 0.44
23 0.53
24 0.61
25 0.69
26 0.74
27 0.76
28 0.81
29 0.87
30 0.86
31 0.85
32 0.79
33 0.73
34 0.67
35 0.63
36 0.52
37 0.44
38 0.4
39 0.3
40 0.31
41 0.27
42 0.26
43 0.24
44 0.25
45 0.25
46 0.22
47 0.24
48 0.2
49 0.2
50 0.21
51 0.21
52 0.23
53 0.25
54 0.27
55 0.28
56 0.32
57 0.32
58 0.31
59 0.3
60 0.28
61 0.29
62 0.26
63 0.27
64 0.22
65 0.21
66 0.19
67 0.16
68 0.15
69 0.12