Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QSF4

Protein Details
Accession M2QSF4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
196-218IKISRIGKKPSSKRHARLVLKNIHydrophilic
NLS Segment(s)
PositionSequence
145-212ARKERKLLKAQELDERRRARAQAKLDRERQKAEAAAHRIARQAAHKRLQKAIKISRIGKKPSSKRHAR
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_42101  -  
Amino Acid Sequences AWCAACKELSILHAFRATGLSPFNPEVILQEFKTTAANSDRGALVASASDWRTIRQLLNQSTSNRSISALNRIMMKLSADTTFLQRENEQLRAALMDEKQWKERIQPGTLELSDGYHGGATFWSPRKKQRDHEESQRQKAITIEARKERKLLKAQELDERRRARAQAKLDRERQKAEAAAHRIARQAAHKRLQKAIKISRIGKKPSSKRHARLVLKNIIVSSSSGGAQPADRSAAPPSPRSCSGRPIKLPIKYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.19
5 0.16
6 0.17
7 0.16
8 0.18
9 0.19
10 0.19
11 0.17
12 0.16
13 0.17
14 0.19
15 0.21
16 0.17
17 0.18
18 0.18
19 0.18
20 0.21
21 0.18
22 0.18
23 0.18
24 0.2
25 0.18
26 0.2
27 0.2
28 0.18
29 0.18
30 0.14
31 0.1
32 0.08
33 0.09
34 0.09
35 0.1
36 0.12
37 0.12
38 0.13
39 0.15
40 0.18
41 0.19
42 0.22
43 0.3
44 0.31
45 0.36
46 0.4
47 0.4
48 0.42
49 0.44
50 0.38
51 0.3
52 0.27
53 0.26
54 0.23
55 0.29
56 0.27
57 0.26
58 0.27
59 0.26
60 0.26
61 0.22
62 0.21
63 0.13
64 0.12
65 0.11
66 0.11
67 0.12
68 0.13
69 0.15
70 0.15
71 0.16
72 0.15
73 0.19
74 0.2
75 0.22
76 0.2
77 0.17
78 0.16
79 0.15
80 0.16
81 0.13
82 0.11
83 0.14
84 0.19
85 0.21
86 0.23
87 0.25
88 0.25
89 0.25
90 0.32
91 0.31
92 0.28
93 0.27
94 0.27
95 0.29
96 0.28
97 0.25
98 0.18
99 0.14
100 0.12
101 0.11
102 0.09
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.08
109 0.13
110 0.17
111 0.19
112 0.27
113 0.36
114 0.41
115 0.48
116 0.55
117 0.59
118 0.61
119 0.69
120 0.73
121 0.72
122 0.72
123 0.68
124 0.57
125 0.49
126 0.43
127 0.37
128 0.32
129 0.3
130 0.31
131 0.35
132 0.39
133 0.39
134 0.41
135 0.4
136 0.4
137 0.43
138 0.43
139 0.44
140 0.47
141 0.48
142 0.54
143 0.57
144 0.55
145 0.55
146 0.52
147 0.45
148 0.42
149 0.43
150 0.38
151 0.38
152 0.43
153 0.44
154 0.52
155 0.57
156 0.64
157 0.7
158 0.69
159 0.66
160 0.58
161 0.52
162 0.46
163 0.42
164 0.4
165 0.36
166 0.37
167 0.36
168 0.35
169 0.34
170 0.31
171 0.29
172 0.3
173 0.34
174 0.37
175 0.43
176 0.47
177 0.49
178 0.56
179 0.6
180 0.58
181 0.58
182 0.59
183 0.58
184 0.61
185 0.64
186 0.65
187 0.66
188 0.67
189 0.66
190 0.68
191 0.69
192 0.73
193 0.76
194 0.78
195 0.76
196 0.8
197 0.83
198 0.81
199 0.81
200 0.79
201 0.77
202 0.69
203 0.64
204 0.54
205 0.44
206 0.36
207 0.28
208 0.21
209 0.13
210 0.12
211 0.11
212 0.11
213 0.11
214 0.12
215 0.12
216 0.12
217 0.13
218 0.13
219 0.14
220 0.18
221 0.24
222 0.26
223 0.31
224 0.33
225 0.37
226 0.43
227 0.48
228 0.47
229 0.5
230 0.57
231 0.6
232 0.62
233 0.65
234 0.68