Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2ST45

Protein Details
Accession M2ST45    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-63PNTRNPFPTKSPKDNKKKRCMPKYELCECFFFPRPYKKKKDNNKEQTPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 14, mito 9.5
Family & Domain DBs
KEGG bsc:COCSADRAFT_35506  -  
Amino Acid Sequences MQINNNTHAAYINNPNTRNPFPTKSPKDNKKKRCMPKYELCECFFFPRPYKKKKDNNKEQTPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.42
4 0.44
5 0.45
6 0.42
7 0.39
8 0.4
9 0.5
10 0.55
11 0.59
12 0.67
13 0.72
14 0.77
15 0.82
16 0.85
17 0.85
18 0.87
19 0.87
20 0.87
21 0.85
22 0.82
23 0.81
24 0.81
25 0.78
26 0.73
27 0.65
28 0.58
29 0.51
30 0.49
31 0.44
32 0.4
33 0.38
34 0.44
35 0.5
36 0.57
37 0.66
38 0.71
39 0.76
40 0.83
41 0.88
42 0.88
43 0.91