Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SIU9

Protein Details
Accession M2SIU9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-67DWEQNRRKEQKSRYRTKPGRCANGTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG bsc:COCSADRAFT_284891  -  
Amino Acid Sequences MRDLLRSRKLLLNGGRTLRVDCQDNKTKVSREGIITSDKRDDWEQNRRKEQKSRYRTKPGRCANGTPGITRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.41
4 0.4
5 0.36
6 0.32
7 0.3
8 0.27
9 0.32
10 0.39
11 0.4
12 0.41
13 0.42
14 0.42
15 0.41
16 0.41
17 0.35
18 0.28
19 0.28
20 0.27
21 0.29
22 0.27
23 0.25
24 0.24
25 0.21
26 0.21
27 0.21
28 0.25
29 0.25
30 0.35
31 0.42
32 0.48
33 0.59
34 0.64
35 0.67
36 0.71
37 0.75
38 0.75
39 0.78
40 0.8
41 0.79
42 0.84
43 0.86
44 0.87
45 0.87
46 0.86
47 0.85
48 0.8
49 0.76
50 0.71
51 0.72
52 0.64