Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59TA3

Protein Details
Accession Q59TA3    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
156-175QTNSATSKRQQKLQARREKGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6, mito 5, extr 4, mito_nucl 4, nucl 3, pero 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0005773  C:vacuole  
GO:0006624  P:vacuolar protein processing  
KEGG cal:CAALFM_C101950CA  -  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MASASAKKLAVANTNILNQLLIISASINIIVFLIISIFHRPSSYKPWIIFSIPSIFLQYSLEKFGRPKYTNGNSLVSSGEDIRLSGSLYEYYFDVIYLTWGFDILMIIFGSNKVWYGYLIIPGFAIYKLSNFILPFIKKNKSNGSTPEEQQAETKQTNSATSKRQQKLQARREKGPAVKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.24
5 0.18
6 0.15
7 0.11
8 0.08
9 0.06
10 0.05
11 0.05
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.03
20 0.03
21 0.04
22 0.05
23 0.08
24 0.09
25 0.09
26 0.1
27 0.12
28 0.16
29 0.24
30 0.29
31 0.32
32 0.32
33 0.36
34 0.38
35 0.38
36 0.35
37 0.29
38 0.27
39 0.23
40 0.22
41 0.2
42 0.17
43 0.16
44 0.16
45 0.15
46 0.12
47 0.14
48 0.14
49 0.14
50 0.15
51 0.21
52 0.28
53 0.28
54 0.3
55 0.36
56 0.41
57 0.45
58 0.46
59 0.43
60 0.35
61 0.34
62 0.31
63 0.22
64 0.18
65 0.12
66 0.1
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.08
104 0.09
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.13
111 0.1
112 0.1
113 0.06
114 0.06
115 0.08
116 0.09
117 0.1
118 0.1
119 0.12
120 0.17
121 0.19
122 0.23
123 0.27
124 0.33
125 0.34
126 0.4
127 0.47
128 0.45
129 0.49
130 0.51
131 0.52
132 0.52
133 0.5
134 0.53
135 0.44
136 0.41
137 0.38
138 0.35
139 0.34
140 0.3
141 0.29
142 0.24
143 0.24
144 0.28
145 0.31
146 0.32
147 0.34
148 0.41
149 0.51
150 0.52
151 0.59
152 0.63
153 0.69
154 0.75
155 0.78
156 0.8
157 0.77
158 0.79
159 0.8
160 0.79
161 0.76