Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2STI2

Protein Details
Accession M2STI2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-89DGPVSAKKPKKVKERQREEMKARBasic
NLS Segment(s)
PositionSequence
72-89AKKPKKVKERQREEMKAR
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
KEGG bsc:COCSADRAFT_63764  -  
Amino Acid Sequences MAKSCTLCSTPRPVLVRCQIDSTEKWHFVCPGACWKAVSGGVEDAKSLKEEFPYYRYGGMWKDRSADGPVSAKKPKKVKERQREEMKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.53
4 0.46
5 0.45
6 0.4
7 0.4
8 0.4
9 0.37
10 0.35
11 0.32
12 0.32
13 0.3
14 0.29
15 0.27
16 0.27
17 0.24
18 0.26
19 0.26
20 0.25
21 0.24
22 0.23
23 0.23
24 0.22
25 0.2
26 0.12
27 0.11
28 0.12
29 0.11
30 0.11
31 0.09
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.1
38 0.11
39 0.13
40 0.16
41 0.16
42 0.17
43 0.16
44 0.17
45 0.19
46 0.25
47 0.26
48 0.24
49 0.26
50 0.26
51 0.28
52 0.29
53 0.26
54 0.22
55 0.25
56 0.28
57 0.31
58 0.38
59 0.41
60 0.45
61 0.53
62 0.58
63 0.63
64 0.71
65 0.77
66 0.8
67 0.85
68 0.89
69 0.91