Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DCE5

Protein Details
Accession B0DCE5   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
50-70DEGRPPPLRLIPKRKRQTPPLBasic
NLS Segment(s)
PositionSequence
57-65LRLIPKRKR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_298178  -  
Amino Acid Sequences MIRDDADRTVALTTTGRGNHFDIEEVCNIDEDANHDISNVFYAAQLHKPDEGRPPPLRLIPKRKRQTPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.18
5 0.19
6 0.2
7 0.19
8 0.2
9 0.17
10 0.17
11 0.17
12 0.15
13 0.14
14 0.12
15 0.12
16 0.1
17 0.09
18 0.08
19 0.1
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.07
27 0.05
28 0.05
29 0.06
30 0.08
31 0.12
32 0.13
33 0.14
34 0.16
35 0.17
36 0.19
37 0.27
38 0.3
39 0.34
40 0.36
41 0.39
42 0.4
43 0.45
44 0.53
45 0.54
46 0.61
47 0.63
48 0.71
49 0.77
50 0.83