Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2STF3

Protein Details
Accession M2STF3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHRKAEKAGBasic
NLS Segment(s)
PositionSequence
8-26RIQREHRKAEKAGTRAPVK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG bsc:COCSADRAFT_40487  -  
Amino Acid Sequences MPISKKDRIQREHRKAEKAGTRAPVKANGLPVKAPKPTSICQNCRREIVNTNKAQLEAHAASHDSVAWPKEKCWPNDFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.75
4 0.72
5 0.65
6 0.6
7 0.56
8 0.52
9 0.48
10 0.47
11 0.43
12 0.38
13 0.36
14 0.36
15 0.32
16 0.3
17 0.29
18 0.31
19 0.29
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.55
30 0.54
31 0.51
32 0.52
33 0.45
34 0.45
35 0.47
36 0.48
37 0.43
38 0.44
39 0.42
40 0.4
41 0.37
42 0.3
43 0.26
44 0.18
45 0.17
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.09
52 0.11
53 0.12
54 0.16
55 0.16
56 0.17
57 0.27
58 0.34
59 0.38