Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TFV8

Protein Details
Accession M2TFV8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32DTPSSIRIRENQRRSRNQRKELIQDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
KEGG bsc:COCSADRAFT_111538  -  
Amino Acid Sequences MSKKGSDTPSSIRIRENQRRSRNQRKELIQDLRRRVQEYEIKGVAATQEMQRAARKVAEENSLLRSLLASRGVTHNEVEAYLRSFNTNTAPTTHTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.63
4 0.64
5 0.7
6 0.79
7 0.86
8 0.89
9 0.89
10 0.88
11 0.86
12 0.83
13 0.8
14 0.78
15 0.78
16 0.74
17 0.72
18 0.7
19 0.67
20 0.62
21 0.57
22 0.48
23 0.45
24 0.44
25 0.4
26 0.39
27 0.33
28 0.31
29 0.28
30 0.27
31 0.2
32 0.15
33 0.12
34 0.06
35 0.08
36 0.09
37 0.1
38 0.11
39 0.12
40 0.12
41 0.13
42 0.13
43 0.14
44 0.16
45 0.18
46 0.18
47 0.19
48 0.21
49 0.2
50 0.19
51 0.16
52 0.14
53 0.12
54 0.12
55 0.13
56 0.1
57 0.11
58 0.14
59 0.17
60 0.18
61 0.18
62 0.17
63 0.15
64 0.15
65 0.15
66 0.13
67 0.13
68 0.14
69 0.14
70 0.14
71 0.14
72 0.15
73 0.19
74 0.2
75 0.19
76 0.21