Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SMW3

Protein Details
Accession M2SMW3   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-82KDCPIHKSRKPEPRKRTTQRKMPHENIHWBasic
NLS Segment(s)
PositionSequence
60-70KSRKPEPRKRT
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005159  WCCH  
KEGG bsc:COCSADRAFT_340557  -  
Pfam View protein in Pfam  
PF03716  WCCH  
Amino Acid Sequences MHRAQVRETPVEHSKLLWTHCRKGCAMHQQQFEDARQVDNHYHSTLPANICEAKDCPIHKSRKPEPRKRTTQRKMPHENIHWSFCYNDQCTIHYSAKAGEGYFPKKKGSRQSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.34
4 0.37
5 0.38
6 0.43
7 0.47
8 0.5
9 0.46
10 0.48
11 0.52
12 0.53
13 0.57
14 0.55
15 0.56
16 0.54
17 0.57
18 0.55
19 0.47
20 0.41
21 0.32
22 0.26
23 0.21
24 0.22
25 0.21
26 0.2
27 0.22
28 0.18
29 0.17
30 0.16
31 0.18
32 0.18
33 0.17
34 0.14
35 0.15
36 0.15
37 0.15
38 0.15
39 0.14
40 0.13
41 0.15
42 0.16
43 0.18
44 0.24
45 0.3
46 0.32
47 0.41
48 0.47
49 0.54
50 0.64
51 0.71
52 0.73
53 0.77
54 0.85
55 0.86
56 0.88
57 0.87
58 0.86
59 0.85
60 0.85
61 0.84
62 0.81
63 0.8
64 0.74
65 0.75
66 0.69
67 0.63
68 0.54
69 0.46
70 0.39
71 0.34
72 0.35
73 0.27
74 0.29
75 0.26
76 0.27
77 0.29
78 0.34
79 0.32
80 0.26
81 0.25
82 0.21
83 0.24
84 0.24
85 0.21
86 0.2
87 0.24
88 0.31
89 0.36
90 0.37
91 0.4
92 0.44
93 0.51
94 0.57