FuNGI

Q59MJ1

Protein Details

Accession

Q59MJ1

Localization Confidence

Medium

Confidence Score

11.4

NoLS Segment(s)

Position	Sequence	Protein Nature
8-40	IYSCDACRSRKIKCNRQTPCASCHKSKRDCVYT	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, plas 9

Family & Domain DBs

InterPro	View protein in InterPro IPR007219 Transcription_factor_dom_fun IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0016020 C:membrane GO:0005634 C:nucleus GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0003700 F:DNA-binding transcription factor activity GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0051701 P:biological process involved in interaction with host GO:1900189 P:positive regulation of cell adhesion involved in single-species biofilm formation GO:0010811 P:positive regulation of cell-substrate adhesion GO:2001040 P:positive regulation of cellular response to drug GO:0006355 P:regulation of DNA-templated transcription GO:0006357 P:regulation of transcription by RNA polymerase II GO:0044011 P:single-species biofilm formation on inanimate substrate
KEGG	cal:CAALFM_C307860CA -
Pfam	View protein in Pfam PF04082 Fungal_trans PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd12148 fungal_TF_MHR cd00067 GAL4

Amino Acid Sequences

MTKRDRTIYSCDACRSRKIKCNRQTPCASCHKSKRDCVYTVSRQRDAQITNRKLDKKTYHQISAIEKKISALEGKKGLLQVETINFNKSFTDQTPLVELQSLFPYLLLSKQDPGCVLVRHHCHHLLEKDPRYFEYSQLLADLSLTKRHHLTARAKALLGEAYIPSPQEGHTIDQLKHVLSLNPNFRFAGNFADPLTSFFSLIPPAWANKQLVDTFFQHIYPVIPIIDETDFNTSINRVLGPQIDGHYINSFPSIGSADDLPFLALFLLVLRISYMYTPGACPVSYDTLRAAETIMKEFDITKTHSLTALQAEIMLRFYKIVAPESYTQSNYVQVSVGVLIQNCYSLALHRDPEYIGEHNPKQQHLRRKIWHLLLRMEVIDSAIFQTILSSNPDASDTKLPQLIDQAPPMEQSIVKHIWRSTDLFVSLRKLVEINSKTSEDTPLETVLELLVEVETKLQAFLATIDSEASTVFYNDLVIFSVNFLLVYMYYSLYLFKGPTPLGNKYLLKSAQILFVDLARTRSTSLFLAYFNLNYIHLVLMITNFLRMRVDCIIHRHLRAQDSSVQDLQCCRYFLKIIFFSHVKELGNYSSSHKYAWQMRKVYLTLAKIMERSSDVLISNDPELVKSAAVDIPVKEINKLLEQYINFKGFTPTTLFDPTDNELIDEMQHENLWNAMENIEYSEKVYSGWIDAIKNVPSNWDWDYWDFLKIS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.64
2	0.61
3	0.6
4	0.63
5	0.68
6	0.72
7	0.74
8	0.81
9	0.79
10	0.84
11	0.85
12	0.81
13	0.78
14	0.79
15	0.76
16	0.75
17	0.77
18	0.78
19	0.77
20	0.81
21	0.83
22	0.79
23	0.75
24	0.73
25	0.72
26	0.73
27	0.74
28	0.73
29	0.67
30	0.61
31	0.6
32	0.6
33	0.54
34	0.53
35	0.54
36	0.52
37	0.55
38	0.62
39	0.65
40	0.62
41	0.67
42	0.66
43	0.65
44	0.7
45	0.7
46	0.67
47	0.64
48	0.66
49	0.67
50	0.67
51	0.63
52	0.54
53	0.46
54	0.41
55	0.39
56	0.36
57	0.32
58	0.26
59	0.27
60	0.29
61	0.3
62	0.32
63	0.32
64	0.3
65	0.25
66	0.23
67	0.2
68	0.2
69	0.25
70	0.23
71	0.26
72	0.25
73	0.25
74	0.24
75	0.22
76	0.23
77	0.19
78	0.24
79	0.21
80	0.22
81	0.27
82	0.27
83	0.26
84	0.24
85	0.23
86	0.18
87	0.2
88	0.19
89	0.14
90	0.13
91	0.13
92	0.11
93	0.13
94	0.15
95	0.15
96	0.19
97	0.21
98	0.22
99	0.22
100	0.24
101	0.25
102	0.24
103	0.26
104	0.28
105	0.34
106	0.35
107	0.4
108	0.41
109	0.4
110	0.45
111	0.46
112	0.47
113	0.5
114	0.55
115	0.55
116	0.53
117	0.52
118	0.5
119	0.46
120	0.39
121	0.36
122	0.29
123	0.24
124	0.23
125	0.21
126	0.16
127	0.15
128	0.17
129	0.12
130	0.18
131	0.18
132	0.2
133	0.21
134	0.24
135	0.28
136	0.33
137	0.4
138	0.43
139	0.51
140	0.5
141	0.49
142	0.47
143	0.44
144	0.36
145	0.28
146	0.19
147	0.11
148	0.1
149	0.1
150	0.1
151	0.09
152	0.09
153	0.09
154	0.11
155	0.12
156	0.14
157	0.19
158	0.24
159	0.24
160	0.28
161	0.29
162	0.25
163	0.26
164	0.24
165	0.21
166	0.22
167	0.28
168	0.33
169	0.33
170	0.34
171	0.33
172	0.32
173	0.3
174	0.26
175	0.26
176	0.2
177	0.19
178	0.18
179	0.19
180	0.19
181	0.19
182	0.22
183	0.15
184	0.14
185	0.13
186	0.13
187	0.13
188	0.13
189	0.14
190	0.11
191	0.12
192	0.14
193	0.18
194	0.17
195	0.17
196	0.21
197	0.2
198	0.2
199	0.22
200	0.22
201	0.22
202	0.22
203	0.2
204	0.17
205	0.16
206	0.15
207	0.12
208	0.11
209	0.08
210	0.07
211	0.07
212	0.09
213	0.09
214	0.08
215	0.09
216	0.12
217	0.12
218	0.12
219	0.13
220	0.11
221	0.11
222	0.11
223	0.1
224	0.07
225	0.09
226	0.1
227	0.1
228	0.11
229	0.12
230	0.13
231	0.14
232	0.14
233	0.14
234	0.13
235	0.12
236	0.11
237	0.1
238	0.07
239	0.08
240	0.08
241	0.07
242	0.07
243	0.08
244	0.07
245	0.08
246	0.08
247	0.07
248	0.06
249	0.06
250	0.05
251	0.04
252	0.03
253	0.03
254	0.04
255	0.04
256	0.04
257	0.04
258	0.04
259	0.05
260	0.05
261	0.06
262	0.05
263	0.06
264	0.06
265	0.08
266	0.09
267	0.08
268	0.09
269	0.1
270	0.14
271	0.14
272	0.15
273	0.14
274	0.15
275	0.15
276	0.14
277	0.13
278	0.1
279	0.11
280	0.11
281	0.11
282	0.1
283	0.1
284	0.1
285	0.11
286	0.12
287	0.13
288	0.14
289	0.15
290	0.15
291	0.15
292	0.15
293	0.15
294	0.13
295	0.11
296	0.09
297	0.08
298	0.08
299	0.08
300	0.08
301	0.07
302	0.06
303	0.06
304	0.06
305	0.07
306	0.08
307	0.1
308	0.1
309	0.12
310	0.15
311	0.19
312	0.2
313	0.19
314	0.19
315	0.17
316	0.2
317	0.17
318	0.15
319	0.11
320	0.09
321	0.09
322	0.08
323	0.08
324	0.06
325	0.06
326	0.06
327	0.06
328	0.06
329	0.05
330	0.06
331	0.05
332	0.05
333	0.08
334	0.09
335	0.1
336	0.11
337	0.12
338	0.11
339	0.13
340	0.15
341	0.13
342	0.13
343	0.17
344	0.17
345	0.21
346	0.23
347	0.23
348	0.28
349	0.32
350	0.4
351	0.44
352	0.52
353	0.53
354	0.58
355	0.63
356	0.63
357	0.63
358	0.56
359	0.5
360	0.43
361	0.38
362	0.31
363	0.25
364	0.17
365	0.12
366	0.09
367	0.06
368	0.05
369	0.04
370	0.04
371	0.04
372	0.05
373	0.05
374	0.06
375	0.07
376	0.07
377	0.07
378	0.07
379	0.09
380	0.09
381	0.11
382	0.14
383	0.14
384	0.15
385	0.17
386	0.17
387	0.16
388	0.19
389	0.2
390	0.17
391	0.17
392	0.16
393	0.14
394	0.15
395	0.15
396	0.11
397	0.09
398	0.09
399	0.13
400	0.16
401	0.16
402	0.18
403	0.18
404	0.19
405	0.21
406	0.23
407	0.19
408	0.18
409	0.18
410	0.17
411	0.18
412	0.19
413	0.18
414	0.16
415	0.14
416	0.12
417	0.12
418	0.2
419	0.21
420	0.21
421	0.23
422	0.24
423	0.24
424	0.25
425	0.26
426	0.18
427	0.18
428	0.16
429	0.14
430	0.13
431	0.12
432	0.11
433	0.08
434	0.07
435	0.05
436	0.04
437	0.03
438	0.03
439	0.03
440	0.04
441	0.04
442	0.04
443	0.04
444	0.04
445	0.04
446	0.04
447	0.05
448	0.06
449	0.06
450	0.06
451	0.07
452	0.07
453	0.07
454	0.06
455	0.07
456	0.05
457	0.05
458	0.05
459	0.05
460	0.06
461	0.06
462	0.06
463	0.06
464	0.06
465	0.06
466	0.06
467	0.06
468	0.05
469	0.05
470	0.05
471	0.05
472	0.04
473	0.05
474	0.06
475	0.06
476	0.06
477	0.06
478	0.07
479	0.07
480	0.08
481	0.08
482	0.08
483	0.11
484	0.11
485	0.15
486	0.2
487	0.22
488	0.24
489	0.29
490	0.3
491	0.28
492	0.34
493	0.3
494	0.27
495	0.26
496	0.25
497	0.24
498	0.23
499	0.23
500	0.17
501	0.17
502	0.18
503	0.16
504	0.17
505	0.12
506	0.13
507	0.13
508	0.14
509	0.15
510	0.13
511	0.15
512	0.14
513	0.13
514	0.15
515	0.15
516	0.14
517	0.13
518	0.13
519	0.11
520	0.1
521	0.1
522	0.08
523	0.07
524	0.07
525	0.06
526	0.06
527	0.07
528	0.07
529	0.09
530	0.08
531	0.09
532	0.1
533	0.1
534	0.14
535	0.16
536	0.18
537	0.19
538	0.25
539	0.33
540	0.36
541	0.37
542	0.39
543	0.4
544	0.42
545	0.4
546	0.37
547	0.36
548	0.36
549	0.38
550	0.37
551	0.33
552	0.3
553	0.31
554	0.31
555	0.28
556	0.25
557	0.22
558	0.2
559	0.23
560	0.25
561	0.31
562	0.32
563	0.31
564	0.35
565	0.35
566	0.35
567	0.35
568	0.36
569	0.28
570	0.24
571	0.24
572	0.21
573	0.22
574	0.21
575	0.22
576	0.25
577	0.25
578	0.25
579	0.24
580	0.28
581	0.37
582	0.45
583	0.48
584	0.46
585	0.48
586	0.53
587	0.52
588	0.51
589	0.47
590	0.4
591	0.36
592	0.34
593	0.34
594	0.29
595	0.29
596	0.25
597	0.22
598	0.22
599	0.18
600	0.18
601	0.17
602	0.17
603	0.18
604	0.18
605	0.16
606	0.16
607	0.15
608	0.13
609	0.14
610	0.14
611	0.12
612	0.11
613	0.12
614	0.11
615	0.13
616	0.15
617	0.13
618	0.16
619	0.2
620	0.21
621	0.19
622	0.2
623	0.21
624	0.24
625	0.25
626	0.22
627	0.24
628	0.25
629	0.29
630	0.34
631	0.34
632	0.29
633	0.29
634	0.31
635	0.26
636	0.27
637	0.27
638	0.22
639	0.24
640	0.28
641	0.28
642	0.25
643	0.28
644	0.29
645	0.28
646	0.26
647	0.23
648	0.19
649	0.18
650	0.18
651	0.16
652	0.14
653	0.11
654	0.12
655	0.11
656	0.11
657	0.12
658	0.12
659	0.12
660	0.11
661	0.1
662	0.1
663	0.1
664	0.14
665	0.15
666	0.14
667	0.14
668	0.15
669	0.14
670	0.14
671	0.15
672	0.13
673	0.12
674	0.16
675	0.17
676	0.17
677	0.19
678	0.23
679	0.24
680	0.26
681	0.24
682	0.25
683	0.23
684	0.26
685	0.27
686	0.26
687	0.27
688	0.27
689	0.33
690	0.3

Q59MJ1

3D AlphaFold-predicted Structure Viewer