Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2S972

Protein Details
Accession M2S972   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30RKHRDDAKRFPCKYCKKYRGSNGFKRRDHLBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
KEGG bsc:COCSADRAFT_60168  -  
Amino Acid Sequences RKHRDDAKRFPCKYCKKYRGSNGFKRRDHLMQHVRNYHHIGEDDRNEHRGFGRGWCPKTGCSHHQEPPHKIGEKFAFSTSTEYIKHRRTIHDESDFPCPQPGCDRINGKGYFRKADLRNHLRKVHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.78
4 0.84
5 0.87
6 0.88
7 0.87
8 0.88
9 0.87
10 0.87
11 0.82
12 0.75
13 0.7
14 0.64
15 0.59
16 0.59
17 0.58
18 0.56
19 0.61
20 0.64
21 0.61
22 0.59
23 0.57
24 0.47
25 0.39
26 0.33
27 0.28
28 0.27
29 0.28
30 0.28
31 0.26
32 0.27
33 0.25
34 0.24
35 0.22
36 0.2
37 0.17
38 0.17
39 0.25
40 0.29
41 0.3
42 0.32
43 0.33
44 0.31
45 0.36
46 0.37
47 0.34
48 0.33
49 0.37
50 0.39
51 0.46
52 0.5
53 0.48
54 0.48
55 0.49
56 0.46
57 0.41
58 0.41
59 0.36
60 0.33
61 0.31
62 0.27
63 0.23
64 0.21
65 0.24
66 0.2
67 0.19
68 0.18
69 0.19
70 0.25
71 0.27
72 0.33
73 0.33
74 0.37
75 0.42
76 0.47
77 0.52
78 0.52
79 0.52
80 0.48
81 0.53
82 0.49
83 0.41
84 0.39
85 0.31
86 0.25
87 0.28
88 0.3
89 0.25
90 0.31
91 0.35
92 0.34
93 0.43
94 0.44
95 0.43
96 0.46
97 0.47
98 0.45
99 0.43
100 0.49
101 0.45
102 0.52
103 0.59
104 0.62
105 0.67
106 0.7