Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DK83

Protein Details
Accession B0DK83   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27SSSGGKSAKKKKWSKGKVKDKAQHTVAHydrophilic
NLS Segment(s)
PositionSequence
6-20KSAKKKKWSKGKVKD
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG lbc:LACBIDRAFT_150287  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SSSGGKSAKKKKWSKGKVKDKAQHTVALDKVTYDRIMKEVPTFKFVSQSILIERLKINGSLARVAIRHMEKEGHIKRIVHHSAQLVYSMSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.91
4 0.91
5 0.92
6 0.9
7 0.85
8 0.82
9 0.73
10 0.67
11 0.58
12 0.53
13 0.44
14 0.38
15 0.31
16 0.23
17 0.22
18 0.18
19 0.17
20 0.12
21 0.11
22 0.11
23 0.12
24 0.12
25 0.16
26 0.2
27 0.2
28 0.23
29 0.24
30 0.22
31 0.25
32 0.24
33 0.23
34 0.18
35 0.18
36 0.15
37 0.19
38 0.19
39 0.16
40 0.16
41 0.15
42 0.15
43 0.14
44 0.14
45 0.11
46 0.12
47 0.12
48 0.13
49 0.13
50 0.12
51 0.13
52 0.18
53 0.17
54 0.17
55 0.18
56 0.19
57 0.19
58 0.3
59 0.33
60 0.33
61 0.36
62 0.35
63 0.37
64 0.45
65 0.49
66 0.4
67 0.4
68 0.38
69 0.37
70 0.36
71 0.35