Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D482

Protein Details
Accession B0D482    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MREKWKKKRSRRLRRKRRKMRARSSTYTYTSBasic
NLS Segment(s)
PositionSequence
3-23EKWKKKRSRRLRRKRRKMRAR
Subcellular Location(s) plas 13, mito 8, E.R. 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_317027  -  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MREKWKKKRSRRLRRKRRKMRARSSTYTYTSRKDMPTNFCRVNAPTSVLAYVTSRSSVQATPRSDEFGVRSIRHCFTPVLAPDMRLSYRLHVHCAPFGSGCTQLSAFWSSVVEVVSWVVQINVLIFSQNQNKCFLPDHLCLSKGILRVRRDYFKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.98
3 0.98
4 0.98
5 0.97
6 0.97
7 0.97
8 0.96
9 0.94
10 0.89
11 0.85
12 0.81
13 0.75
14 0.71
15 0.64
16 0.56
17 0.51
18 0.49
19 0.45
20 0.44
21 0.46
22 0.47
23 0.49
24 0.53
25 0.51
26 0.47
27 0.46
28 0.42
29 0.38
30 0.31
31 0.28
32 0.21
33 0.2
34 0.19
35 0.16
36 0.15
37 0.13
38 0.12
39 0.09
40 0.09
41 0.08
42 0.09
43 0.11
44 0.12
45 0.16
46 0.22
47 0.23
48 0.25
49 0.25
50 0.27
51 0.25
52 0.25
53 0.22
54 0.2
55 0.21
56 0.19
57 0.21
58 0.21
59 0.22
60 0.22
61 0.22
62 0.16
63 0.14
64 0.18
65 0.17
66 0.18
67 0.17
68 0.17
69 0.16
70 0.18
71 0.17
72 0.14
73 0.14
74 0.12
75 0.18
76 0.18
77 0.22
78 0.22
79 0.23
80 0.23
81 0.24
82 0.23
83 0.16
84 0.16
85 0.14
86 0.13
87 0.12
88 0.12
89 0.11
90 0.1
91 0.12
92 0.13
93 0.11
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.08
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.05
111 0.06
112 0.06
113 0.11
114 0.19
115 0.23
116 0.24
117 0.27
118 0.27
119 0.29
120 0.33
121 0.33
122 0.31
123 0.32
124 0.38
125 0.37
126 0.38
127 0.36
128 0.36
129 0.35
130 0.34
131 0.37
132 0.37
133 0.38
134 0.45
135 0.51