Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TDA8

Protein Details
Accession M2TDA8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-32VQMLKRPFSNPLKKRRKLPRSTTESPCLHydrophilic
NLS Segment(s)
PositionSequence
16-22LKKRRKL
Subcellular Location(s) nucl 13.5, mito_nucl 11.5, mito 8.5, cyto 5
Family & Domain DBs
KEGG bsc:COCSADRAFT_34077  -  
Amino Acid Sequences MGGLVQMLKRPFSNPLKKRRKLPRSTTESPCLNYEQKVGVIGIDPEKLVKKLELKFPCGFDVHMMHNTYIIQGCEPLTSTDLDDCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.59
3 0.68
4 0.73
5 0.82
6 0.84
7 0.85
8 0.84
9 0.86
10 0.85
11 0.84
12 0.85
13 0.81
14 0.77
15 0.69
16 0.61
17 0.52
18 0.46
19 0.38
20 0.31
21 0.26
22 0.2
23 0.17
24 0.16
25 0.14
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.08
34 0.08
35 0.08
36 0.1
37 0.15
38 0.18
39 0.27
40 0.3
41 0.35
42 0.37
43 0.38
44 0.38
45 0.32
46 0.29
47 0.23
48 0.23
49 0.2
50 0.22
51 0.22
52 0.2
53 0.2
54 0.2
55 0.19
56 0.18
57 0.15
58 0.11
59 0.1
60 0.11
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.13