Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SUW9

Protein Details
Accession M2SUW9   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
186-217KQDLRFRRRMAVKARKERARNGQKTPRIRMPGBasic
NLS Segment(s)
PositionSequence
185-214PKQDLRFRRRMAVKARKERARNGQKTPRIR
Subcellular Location(s) cysk 16, cyto 4.5, cyto_nucl 3.5, mito 3, nucl 1.5
Family & Domain DBs
KEGG bsc:COCSADRAFT_163296  -  
Amino Acid Sequences MYLPEDAFQMQLELIEGFCKVIRDNSFDSMYYSLSSRIDYPGLDIKGDLLDYLQLGGGDLVESLFLGRNDSYESFITGDEFLTWLSKSSLNVEQLVMNQIAKLGPGALLKSWPYDQRVVFRTLETGEWKLGFEWALDEEACGYLLVSEYQCLTIESEHFSYSYMKRPFLEHIWKRIPGELEEWKPKQDLRFRRRMAVKARKERARNGQKTPRIRMPGAWVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.15
9 0.18
10 0.23
11 0.27
12 0.31
13 0.32
14 0.31
15 0.33
16 0.27
17 0.25
18 0.21
19 0.18
20 0.15
21 0.14
22 0.14
23 0.13
24 0.14
25 0.14
26 0.13
27 0.16
28 0.21
29 0.21
30 0.2
31 0.19
32 0.17
33 0.17
34 0.17
35 0.13
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.05
53 0.07
54 0.07
55 0.08
56 0.1
57 0.11
58 0.13
59 0.12
60 0.13
61 0.12
62 0.12
63 0.13
64 0.1
65 0.1
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.12
76 0.16
77 0.17
78 0.17
79 0.17
80 0.16
81 0.16
82 0.17
83 0.14
84 0.09
85 0.08
86 0.08
87 0.07
88 0.06
89 0.06
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.09
99 0.1
100 0.12
101 0.15
102 0.16
103 0.2
104 0.23
105 0.25
106 0.24
107 0.22
108 0.21
109 0.18
110 0.19
111 0.16
112 0.15
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.09
119 0.07
120 0.06
121 0.06
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.08
142 0.11
143 0.12
144 0.12
145 0.12
146 0.12
147 0.15
148 0.17
149 0.25
150 0.24
151 0.25
152 0.26
153 0.28
154 0.32
155 0.35
156 0.45
157 0.41
158 0.47
159 0.51
160 0.53
161 0.52
162 0.52
163 0.46
164 0.37
165 0.38
166 0.37
167 0.38
168 0.43
169 0.44
170 0.42
171 0.41
172 0.42
173 0.44
174 0.46
175 0.5
176 0.5
177 0.59
178 0.6
179 0.68
180 0.72
181 0.73
182 0.74
183 0.74
184 0.76
185 0.77
186 0.83
187 0.83
188 0.82
189 0.83
190 0.83
191 0.83
192 0.81
193 0.8
194 0.81
195 0.81
196 0.85
197 0.84
198 0.82
199 0.78
200 0.72
201 0.65