Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2RY36

Protein Details
Accession M2RY36    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-33YLKATISKVTKRKTRKRRYIAKVEGGSHydrophilic
NLS Segment(s)
PositionSequence
17-24KRKTRKRR
Subcellular Location(s) mito 15, nucl 11, cyto_nucl 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_346407  -  
Amino Acid Sequences MHEKLNYLKATISKVTKRKTRKRRYIAKVEGGSCNEGVTPAKRVRSERRCGRCSQVGHNSRTCQVELEDIEDSDVSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.58
4 0.66
5 0.73
6 0.78
7 0.83
8 0.85
9 0.88
10 0.9
11 0.91
12 0.91
13 0.89
14 0.86
15 0.8
16 0.71
17 0.64
18 0.55
19 0.46
20 0.35
21 0.27
22 0.18
23 0.13
24 0.12
25 0.09
26 0.12
27 0.13
28 0.16
29 0.19
30 0.24
31 0.34
32 0.41
33 0.5
34 0.56
35 0.63
36 0.64
37 0.65
38 0.66
39 0.63
40 0.58
41 0.57
42 0.57
43 0.55
44 0.57
45 0.59
46 0.55
47 0.51
48 0.5
49 0.42
50 0.33
51 0.27
52 0.27
53 0.23
54 0.24
55 0.21
56 0.19
57 0.19
58 0.17