Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SDZ3

Protein Details
Accession M2SDZ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-50LGKQRRYRSKSRSGRRPASTHydrophilic
NLS Segment(s)
PositionSequence
38-43RSKSRS
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_245508  -  
Amino Acid Sequences MFISRCTGWVVQWAATLLFRWWKRGMFDVCLGKQRRYRSKSRSGRRPASTICGRGAFSFLYVLNQLVSPSAMESSADEDGLKQEKKSRPWSMSWVRVCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.13
5 0.18
6 0.18
7 0.22
8 0.23
9 0.25
10 0.27
11 0.34
12 0.36
13 0.31
14 0.37
15 0.39
16 0.39
17 0.44
18 0.45
19 0.42
20 0.43
21 0.48
22 0.52
23 0.51
24 0.58
25 0.58
26 0.67
27 0.72
28 0.78
29 0.8
30 0.79
31 0.82
32 0.76
33 0.72
34 0.63
35 0.6
36 0.53
37 0.45
38 0.37
39 0.3
40 0.27
41 0.22
42 0.22
43 0.14
44 0.11
45 0.1
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.05
59 0.05
60 0.06
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.12
67 0.18
68 0.18
69 0.16
70 0.25
71 0.31
72 0.39
73 0.48
74 0.54
75 0.53
76 0.57
77 0.65
78 0.67
79 0.7