Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SSR8

Protein Details
Accession M2SSR8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25IIAEEVRRRRRGRKLYYEVKWKGFHydrophilic
NLS Segment(s)
PositionSequence
8-15RRRRRGRK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
KEGG bsc:COCSADRAFT_164030  -  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences DIIAEEVRRRRRGRKLYYEVKWKGFHRTTLEPAELLEDAEAVDRWEAFTETKRDSEGRLPEGFRRGDAVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.82
4 0.85
5 0.86
6 0.81
7 0.76
8 0.71
9 0.61
10 0.61
11 0.53
12 0.5
13 0.45
14 0.44
15 0.43
16 0.41
17 0.4
18 0.3
19 0.28
20 0.25
21 0.19
22 0.14
23 0.09
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.07
35 0.11
36 0.15
37 0.17
38 0.18
39 0.21
40 0.21
41 0.23
42 0.29
43 0.31
44 0.31
45 0.33
46 0.35
47 0.37
48 0.43
49 0.41
50 0.34
51 0.32