Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SMU7

Protein Details
Accession M2SMU7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-68QRKPRVALACKRCKRRKQRCDGARPVCRSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG bsc:COCSADRAFT_279537  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSQSYAESLLSPSGSADDQIPASSTAIEIPSNSTSAGAQRKPRVALACKRCKRRKQRCDGARPVCRSCERAGVACAYERTLRPQYPGGKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.1
6 0.1
7 0.11
8 0.1
9 0.1
10 0.09
11 0.08
12 0.08
13 0.09
14 0.08
15 0.07
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.13
23 0.19
24 0.19
25 0.24
26 0.27
27 0.29
28 0.3
29 0.33
30 0.33
31 0.33
32 0.38
33 0.43
34 0.5
35 0.55
36 0.64
37 0.7
38 0.76
39 0.81
40 0.84
41 0.85
42 0.85
43 0.89
44 0.89
45 0.91
46 0.91
47 0.9
48 0.87
49 0.82
50 0.73
51 0.68
52 0.61
53 0.54
54 0.45
55 0.43
56 0.37
57 0.34
58 0.33
59 0.29
60 0.28
61 0.27
62 0.26
63 0.2
64 0.21
65 0.2
66 0.25
67 0.3
68 0.3
69 0.32
70 0.39
71 0.45