Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2S2L7

Protein Details
Accession M2S2L7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
113-134TVQALRHKARRKNKKSAPVLDAHydrophilic
NLS Segment(s)
PositionSequence
118-127RHKARRKNKK
Subcellular Location(s) nucl 12, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG bsc:COCSADRAFT_162891  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MVPNDEIKARERFLQEAAHLLAVSSPTAAAFIGRAHHKFIEDAEIEIPSKEADAYRRSICNACGNIMIPGWSCKVSNHLPGEGPTRKDNKGFKKLPQLEKSIRYTCLMCHRETVQALRHKARRKNKKSAPVLDAAPVPTSNNPAKEVDNAPKTLNASSKQRQKARKGGLQAMLDKKKSQNSASGGLDLMDFAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.3
4 0.3
5 0.24
6 0.21
7 0.19
8 0.17
9 0.13
10 0.12
11 0.08
12 0.06
13 0.05
14 0.06
15 0.06
16 0.05
17 0.05
18 0.06
19 0.1
20 0.15
21 0.17
22 0.2
23 0.21
24 0.21
25 0.21
26 0.21
27 0.24
28 0.19
29 0.2
30 0.17
31 0.17
32 0.17
33 0.16
34 0.15
35 0.08
36 0.08
37 0.07
38 0.08
39 0.11
40 0.13
41 0.17
42 0.2
43 0.21
44 0.24
45 0.25
46 0.26
47 0.29
48 0.28
49 0.25
50 0.23
51 0.22
52 0.2
53 0.19
54 0.17
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.14
62 0.16
63 0.22
64 0.23
65 0.23
66 0.23
67 0.24
68 0.31
69 0.29
70 0.28
71 0.27
72 0.29
73 0.29
74 0.34
75 0.4
76 0.42
77 0.49
78 0.49
79 0.49
80 0.56
81 0.63
82 0.66
83 0.62
84 0.6
85 0.54
86 0.56
87 0.57
88 0.48
89 0.41
90 0.34
91 0.31
92 0.27
93 0.33
94 0.3
95 0.25
96 0.25
97 0.25
98 0.27
99 0.28
100 0.28
101 0.25
102 0.29
103 0.33
104 0.37
105 0.42
106 0.46
107 0.54
108 0.62
109 0.66
110 0.68
111 0.76
112 0.78
113 0.82
114 0.83
115 0.82
116 0.75
117 0.68
118 0.6
119 0.51
120 0.44
121 0.34
122 0.26
123 0.18
124 0.15
125 0.12
126 0.16
127 0.17
128 0.18
129 0.19
130 0.2
131 0.21
132 0.24
133 0.28
134 0.31
135 0.32
136 0.32
137 0.31
138 0.31
139 0.31
140 0.3
141 0.3
142 0.26
143 0.31
144 0.38
145 0.47
146 0.54
147 0.61
148 0.67
149 0.71
150 0.77
151 0.77
152 0.76
153 0.73
154 0.72
155 0.71
156 0.66
157 0.65
158 0.65
159 0.62
160 0.58
161 0.54
162 0.51
163 0.51
164 0.52
165 0.47
166 0.45
167 0.43
168 0.48
169 0.47
170 0.43
171 0.36
172 0.31
173 0.28