Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TAF3

Protein Details
Accession M2TAF3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
236-260GKEKGVEDKRNGKRKHKYVEAEGTPBasic
NLS Segment(s)
PositionSequence
243-251DKRNGKRKH
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
KEGG bsc:COCSADRAFT_86286  -  
Amino Acid Sequences TKKSDAYVAKPKPAIKKVKVVNRGSEIKQMTATAEAARKSATSSKQSSSLNPIPQRPSDWTHNAHSSGRILIRKNAASRIIQRNDAVGKTEAPISQPKAKKIATEKKDGLYNASSQRKSALPGLDTVATAATTTKQSVPSECLTLQRMGNKAIRSLEEPVSVPRTHKPSNAPTACSTENVKAAEPTKNDKLHTVDTENRTQTQTQSSESKPSSLKDEVGGCGEPDSRASSEDKFLGKEKGVEDKRNGKRKHKYVEAEGTPNKKVQLSGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.67
4 0.69
5 0.74
6 0.78
7 0.74
8 0.72
9 0.69
10 0.7
11 0.63
12 0.63
13 0.55
14 0.46
15 0.42
16 0.35
17 0.29
18 0.24
19 0.23
20 0.18
21 0.2
22 0.19
23 0.18
24 0.18
25 0.17
26 0.18
27 0.24
28 0.26
29 0.3
30 0.33
31 0.35
32 0.41
33 0.43
34 0.43
35 0.45
36 0.46
37 0.47
38 0.47
39 0.5
40 0.49
41 0.49
42 0.49
43 0.45
44 0.44
45 0.43
46 0.44
47 0.43
48 0.43
49 0.46
50 0.45
51 0.42
52 0.38
53 0.32
54 0.29
55 0.29
56 0.29
57 0.26
58 0.28
59 0.32
60 0.34
61 0.35
62 0.35
63 0.34
64 0.33
65 0.4
66 0.44
67 0.42
68 0.41
69 0.39
70 0.38
71 0.37
72 0.34
73 0.29
74 0.2
75 0.18
76 0.16
77 0.18
78 0.15
79 0.15
80 0.18
81 0.2
82 0.27
83 0.29
84 0.31
85 0.35
86 0.35
87 0.38
88 0.44
89 0.5
90 0.46
91 0.51
92 0.51
93 0.47
94 0.5
95 0.45
96 0.38
97 0.29
98 0.29
99 0.29
100 0.34
101 0.32
102 0.28
103 0.3
104 0.27
105 0.28
106 0.28
107 0.22
108 0.16
109 0.17
110 0.18
111 0.16
112 0.15
113 0.14
114 0.1
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.06
121 0.07
122 0.1
123 0.1
124 0.11
125 0.15
126 0.15
127 0.17
128 0.16
129 0.17
130 0.17
131 0.18
132 0.18
133 0.18
134 0.19
135 0.19
136 0.23
137 0.21
138 0.21
139 0.2
140 0.21
141 0.19
142 0.22
143 0.2
144 0.17
145 0.18
146 0.18
147 0.2
148 0.19
149 0.19
150 0.19
151 0.25
152 0.25
153 0.28
154 0.32
155 0.35
156 0.45
157 0.46
158 0.45
159 0.4
160 0.43
161 0.41
162 0.36
163 0.32
164 0.24
165 0.25
166 0.23
167 0.22
168 0.19
169 0.21
170 0.24
171 0.24
172 0.28
173 0.32
174 0.34
175 0.34
176 0.35
177 0.36
178 0.36
179 0.37
180 0.36
181 0.36
182 0.38
183 0.43
184 0.42
185 0.4
186 0.38
187 0.35
188 0.32
189 0.31
190 0.29
191 0.26
192 0.3
193 0.3
194 0.35
195 0.35
196 0.37
197 0.32
198 0.32
199 0.34
200 0.3
201 0.3
202 0.25
203 0.27
204 0.24
205 0.25
206 0.24
207 0.18
208 0.17
209 0.17
210 0.14
211 0.13
212 0.15
213 0.13
214 0.14
215 0.17
216 0.17
217 0.2
218 0.24
219 0.24
220 0.23
221 0.26
222 0.28
223 0.27
224 0.28
225 0.27
226 0.34
227 0.39
228 0.43
229 0.47
230 0.54
231 0.62
232 0.69
233 0.74
234 0.73
235 0.78
236 0.81
237 0.84
238 0.83
239 0.81
240 0.81
241 0.84
242 0.79
243 0.78
244 0.76
245 0.71
246 0.63
247 0.58
248 0.5
249 0.41