Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SXE4

Protein Details
Accession M2SXE4   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
167-189GLWFKVKGKKDNKMRLRRIKDVAHydrophilic
NLS Segment(s)
PositionSequence
173-184KGKKDNKMRLRR
Subcellular Location(s) cyto 14.5, cyto_mito 11.5, mito 7.5, nucl 4
Family & Domain DBs
KEGG bsc:COCSADRAFT_28927  -  
Amino Acid Sequences MPFVSLGGWLTLVGMPQPKVRPKRADPGEEEYIGEDASGVSDHELAVDQDELDADMHDLHDTNETDEAILDDESVASDDSEAVEVDDSEDVVAELGPEDALAEEKMLNDVAATDGYKENLAKRRGRYCTIFRRATASAADKNQPTIPVEDPDTSYGGAMDVKPCKNGLWFKVKGKKDNKMRLRRIKDVAIPKWGINHECDCDQCKKQVEFKNHCAGYTGKPSGMTRSNKTFKPNVGYTLGSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.19
4 0.26
5 0.34
6 0.42
7 0.5
8 0.57
9 0.6
10 0.69
11 0.72
12 0.73
13 0.7
14 0.7
15 0.67
16 0.58
17 0.52
18 0.42
19 0.35
20 0.26
21 0.2
22 0.12
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.11
53 0.11
54 0.11
55 0.08
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.06
103 0.07
104 0.07
105 0.11
106 0.18
107 0.23
108 0.26
109 0.3
110 0.37
111 0.41
112 0.44
113 0.45
114 0.47
115 0.52
116 0.56
117 0.54
118 0.47
119 0.48
120 0.45
121 0.41
122 0.35
123 0.28
124 0.24
125 0.24
126 0.27
127 0.22
128 0.23
129 0.22
130 0.21
131 0.18
132 0.17
133 0.16
134 0.15
135 0.17
136 0.16
137 0.17
138 0.17
139 0.16
140 0.14
141 0.12
142 0.1
143 0.08
144 0.08
145 0.07
146 0.1
147 0.14
148 0.14
149 0.15
150 0.16
151 0.16
152 0.21
153 0.25
154 0.27
155 0.31
156 0.35
157 0.43
158 0.52
159 0.56
160 0.6
161 0.63
162 0.67
163 0.69
164 0.75
165 0.77
166 0.79
167 0.84
168 0.86
169 0.86
170 0.84
171 0.79
172 0.74
173 0.71
174 0.7
175 0.63
176 0.6
177 0.54
178 0.46
179 0.46
180 0.43
181 0.37
182 0.32
183 0.31
184 0.27
185 0.28
186 0.3
187 0.29
188 0.32
189 0.33
190 0.36
191 0.4
192 0.41
193 0.48
194 0.54
195 0.6
196 0.63
197 0.68
198 0.72
199 0.64
200 0.6
201 0.54
202 0.49
203 0.44
204 0.44
205 0.39
206 0.3
207 0.33
208 0.34
209 0.38
210 0.43
211 0.44
212 0.41
213 0.49
214 0.54
215 0.55
216 0.61
217 0.61
218 0.59
219 0.61
220 0.57
221 0.52
222 0.5
223 0.47