Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RA15

Protein Details
Accession M2RA15    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKVPWRLSRHQKYRHRERLRHVDSVHydrophilic
77-103KYTVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-94VKRYRKGIHK
Subcellular Location(s) mito 18, mito_nucl 12, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG bsc:COCSADRAFT_171968  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSGGLLWKVPWRLSRHQKYRHRERLRHVDSVVSALDTALRRMGQSMKKVERWKTEMPTEEEMLPKDKYTVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.89
17 0.9
18 0.89
19 0.85
20 0.85
21 0.85
22 0.81
23 0.75
24 0.64
25 0.55
26 0.45
27 0.4
28 0.3
29 0.19
30 0.13
31 0.09
32 0.11
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.09
39 0.15
40 0.16
41 0.2
42 0.27
43 0.3
44 0.36
45 0.41
46 0.45
47 0.45
48 0.48
49 0.48
50 0.45
51 0.46
52 0.45
53 0.44
54 0.42
55 0.38
56 0.33
57 0.3
58 0.26
59 0.25
60 0.21
61 0.16
62 0.15
63 0.14
64 0.16
65 0.21
66 0.29
67 0.31
68 0.39
69 0.45
70 0.54
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79