Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2S3R1

Protein Details
Accession M2S3R1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-52SLRLKLKKYKFYKNKVNFLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9, mito 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
KEGG bsc:COCSADRAFT_94862  -  
PROSITE View protein in PROSITE  
PS50878  RT_POL  
Amino Acid Sequences IITYLNNILIYLENKKDYILYIKTVLKKLDKYSLRLKLKKYKFYKNKVNFLGYTIRANRVQISEEKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.17
5 0.21
6 0.19
7 0.18
8 0.21
9 0.26
10 0.3
11 0.32
12 0.33
13 0.31
14 0.32
15 0.32
16 0.37
17 0.34
18 0.35
19 0.41
20 0.48
21 0.52
22 0.54
23 0.57
24 0.58
25 0.63
26 0.68
27 0.67
28 0.68
29 0.7
30 0.75
31 0.8
32 0.78
33 0.81
34 0.76
35 0.74
36 0.63
37 0.57
38 0.54
39 0.45
40 0.43
41 0.36
42 0.36
43 0.32
44 0.33
45 0.33
46 0.28
47 0.3