Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TB30

Protein Details
Accession M2TB30    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-32PTTAQLARKRERNRESQRRSRQRVKDQIDAHydrophilic
NLS Segment(s)
PositionSequence
11-22KRERNRESQRRS
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG bsc:COCSADRAFT_158234  -  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MKPTTAQLARKRERNRESQRRSRQRVKDQIDALERQNRELELDSRSLQKQLLRALEAIEVFEKGASLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.8
4 0.83
5 0.85
6 0.88
7 0.88
8 0.91
9 0.9
10 0.88
11 0.88
12 0.88
13 0.83
14 0.79
15 0.7
16 0.67
17 0.6
18 0.52
19 0.44
20 0.4
21 0.34
22 0.27
23 0.26
24 0.2
25 0.18
26 0.18
27 0.17
28 0.13
29 0.16
30 0.16
31 0.19
32 0.19
33 0.19
34 0.19
35 0.19
36 0.21
37 0.24
38 0.26
39 0.24
40 0.24
41 0.24
42 0.24
43 0.22
44 0.2
45 0.15
46 0.12
47 0.11
48 0.1