FuNGI

A0A1D8PJG1

Protein Details

Accession

A0A1D8PJG1

Localization Confidence

Medium

Confidence Score

13.9

NoLS Segment(s)

Position	Sequence	Protein Nature
31-60	QQSQAIQQKNKEKQQSRQKEQQEKHQQQQQ	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 24, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR002975 Fungi_Gprotein_alpha IPR001019 Gprotein_alpha_su IPR011025 GproteinA_insert IPR027417 P-loop_NTPase
Gene Ontology	GO:0005834 C:heterotrimeric G-protein complex GO:0001664 F:G protein-coupled receptor binding GO:0031683 F:G-protein beta/gamma-subunit complex binding GO:0005525 F:GTP binding GO:0003924 F:GTPase activity GO:0007189 P:adenylate cyclase-activating G protein-coupled receptor signaling pathway GO:0030437 P:ascospore formation GO:0019933 P:cAMP-mediated signaling GO:0071333 P:cellular response to glucose stimulus GO:0036244 P:cellular response to neutral pH GO:0009267 P:cellular response to starvation GO:0030447 P:filamentous growth GO:0044182 P:filamentous growth of a population of unicellular organisms GO:0036180 P:filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:0036168 P:filamentous growth of a population of unicellular organisms in response to heat GO:0036178 P:filamentous growth of a population of unicellular organisms in response to neutral pH GO:0036170 P:filamentous growth of a population of unicellular organisms in response to starvation GO:0010255 P:glucose mediated signaling pathway GO:0006878 P:intracellular copper ion homeostasis GO:0001403 P:invasive growth in response to glucose limitation GO:0036165 P:invasive growth in response to heat GO:1900445 P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:1900433 P:positive regulation of filamentous growth of a population of unicellular organisms in response to heat GO:1900442 P:positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH GO:1900436 P:positive regulation of filamentous growth of a population of unicellular organisms in response to starvation GO:0010737 P:protein kinase A signaling GO:0007124 P:pseudohyphal growth GO:0000749 P:response to pheromone triggering conjugation with cellular fusion GO:0001402 P:signal transduction involved in filamentous growth
KEGG	cal:CAALFM_C302240CA -
Pfam	View protein in Pfam PF00503 G-alpha
PROSITE	View protein in PROSITE PS51882 G_ALPHA
CDD	cd00066 G-alpha

Amino Acid Sequences

MGSCASKSADQGNGTSKQQQSAQSTQGKRQQQSQAIQQKNKEKQQSRQKEQQEKHQQQQQQQPQPQSPSDSNADGTLKNGSDFYETLKHPSDSSNDNGHLKENHSQDLSNGTANKNLITNPVDAAGNSNPSKDVKVLLLGSGESGKSTIVKQMKILHSDGYTQDELEEYRPFVYKNILDCIKNVINAIIDLQPDLIRKPDSPQLEEDHEEDLKVTGLTSENNHVPTANGSVTNQPPPPPKQRKHILEYDMLNEILDYDYPLNLNQQFDPDIAIKIKKVYETPEVKEFMLQRQGDFYLIDSTDYFLSNLDRICLAGNYEPNVTDVLRTRKKTSGIFIYTFDLGNGLNMNLFDVGGQRSERKKWINCFDNVSTIIFCVALSEYDNFLLEESNTNRLEESLALFDSVVNSRWFSRTTVVLFLNKIDVFAEKLKYSPLENFFPDYKGGSNISNGVKYILWRFNKLNRSGLNIYPHVTQATDTSNIELVMAAVKQTILENSLKDSGIL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.36
2	0.42
3	0.39
4	0.37
5	0.4
6	0.44
7	0.45
8	0.46
9	0.52
10	0.54
11	0.56
12	0.6
13	0.64
14	0.65
15	0.61
16	0.64
17	0.65
18	0.64
19	0.66
20	0.68
21	0.7
22	0.71
23	0.74
24	0.74
25	0.74
26	0.75
27	0.78
28	0.78
29	0.75
30	0.76
31	0.81
32	0.85
33	0.83
34	0.84
35	0.85
36	0.85
37	0.83
38	0.84
39	0.84
40	0.81
41	0.81
42	0.79
43	0.75
44	0.73
45	0.79
46	0.78
47	0.77
48	0.75
49	0.74
50	0.72
51	0.71
52	0.65
53	0.61
54	0.52
55	0.47
56	0.44
57	0.38
58	0.33
59	0.31
60	0.3
61	0.24
62	0.23
63	0.21
64	0.18
65	0.16
66	0.16
67	0.14
68	0.15
69	0.15
70	0.18
71	0.21
72	0.22
73	0.26
74	0.29
75	0.29
76	0.27
77	0.29
78	0.29
79	0.26
80	0.3
81	0.31
82	0.31
83	0.33
84	0.33
85	0.34
86	0.33
87	0.32
88	0.34
89	0.31
90	0.31
91	0.29
92	0.29
93	0.26
94	0.28
95	0.26
96	0.23
97	0.22
98	0.19
99	0.21
100	0.21
101	0.21
102	0.18
103	0.17
104	0.18
105	0.18
106	0.18
107	0.15
108	0.17
109	0.16
110	0.14
111	0.18
112	0.14
113	0.18
114	0.17
115	0.17
116	0.17
117	0.18
118	0.19
119	0.17
120	0.17
121	0.12
122	0.15
123	0.15
124	0.14
125	0.14
126	0.12
127	0.12
128	0.12
129	0.1
130	0.07
131	0.07
132	0.06
133	0.07
134	0.08
135	0.14
136	0.17
137	0.18
138	0.21
139	0.29
140	0.33
141	0.35
142	0.36
143	0.31
144	0.27
145	0.29
146	0.27
147	0.24
148	0.2
149	0.17
150	0.16
151	0.14
152	0.14
153	0.13
154	0.13
155	0.09
156	0.1
157	0.11
158	0.11
159	0.11
160	0.15
161	0.16
162	0.17
163	0.23
164	0.25
165	0.24
166	0.24
167	0.3
168	0.27
169	0.25
170	0.22
171	0.17
172	0.14
173	0.14
174	0.15
175	0.1
176	0.09
177	0.08
178	0.09
179	0.09
180	0.09
181	0.1
182	0.1
183	0.1
184	0.1
185	0.14
186	0.19
187	0.2
188	0.22
189	0.24
190	0.26
191	0.28
192	0.29
193	0.27
194	0.23
195	0.2
196	0.18
197	0.16
198	0.13
199	0.09
200	0.08
201	0.06
202	0.05
203	0.05
204	0.06
205	0.07
206	0.1
207	0.11
208	0.13
209	0.13
210	0.12
211	0.12
212	0.12
213	0.13
214	0.1
215	0.09
216	0.09
217	0.13
218	0.14
219	0.17
220	0.17
221	0.18
222	0.23
223	0.27
224	0.38
225	0.44
226	0.46
227	0.52
228	0.6
229	0.63
230	0.64
231	0.66
232	0.58
233	0.53
234	0.5
235	0.43
236	0.35
237	0.29
238	0.23
239	0.16
240	0.12
241	0.08
242	0.06
243	0.05
244	0.04
245	0.04
246	0.05
247	0.05
248	0.07
249	0.09
250	0.1
251	0.09
252	0.1
253	0.11
254	0.11
255	0.12
256	0.11
257	0.11
258	0.11
259	0.11
260	0.11
261	0.12
262	0.13
263	0.12
264	0.12
265	0.15
266	0.22
267	0.26
268	0.28
269	0.31
270	0.32
271	0.31
272	0.33
273	0.3
274	0.25
275	0.28
276	0.25
277	0.21
278	0.21
279	0.21
280	0.19
281	0.18
282	0.15
283	0.1
284	0.1
285	0.11
286	0.09
287	0.09
288	0.09
289	0.1
290	0.09
291	0.07
292	0.07
293	0.08
294	0.08
295	0.08
296	0.07
297	0.07
298	0.08
299	0.08
300	0.08
301	0.09
302	0.11
303	0.12
304	0.12
305	0.12
306	0.12
307	0.13
308	0.11
309	0.11
310	0.14
311	0.22
312	0.28
313	0.31
314	0.34
315	0.38
316	0.42
317	0.43
318	0.43
319	0.43
320	0.41
321	0.4
322	0.38
323	0.36
324	0.32
325	0.3
326	0.24
327	0.16
328	0.11
329	0.09
330	0.08
331	0.06
332	0.05
333	0.05
334	0.06
335	0.05
336	0.05
337	0.05
338	0.06
339	0.07
340	0.08
341	0.09
342	0.14
343	0.18
344	0.22
345	0.28
346	0.35
347	0.41
348	0.48
349	0.57
350	0.59
351	0.58
352	0.62
353	0.57
354	0.53
355	0.47
356	0.4
357	0.3
358	0.23
359	0.2
360	0.13
361	0.11
362	0.08
363	0.07
364	0.06
365	0.08
366	0.09
367	0.09
368	0.1
369	0.1
370	0.09
371	0.09
372	0.09
373	0.08
374	0.12
375	0.13
376	0.19
377	0.19
378	0.19
379	0.19
380	0.19
381	0.19
382	0.15
383	0.15
384	0.11
385	0.11
386	0.11
387	0.11
388	0.11
389	0.12
390	0.12
391	0.12
392	0.11
393	0.12
394	0.13
395	0.16
396	0.17
397	0.17
398	0.19
399	0.21
400	0.22
401	0.26
402	0.28
403	0.29
404	0.28
405	0.27
406	0.29
407	0.24
408	0.22
409	0.17
410	0.15
411	0.16
412	0.19
413	0.21
414	0.17
415	0.18
416	0.2
417	0.21
418	0.22
419	0.26
420	0.27
421	0.29
422	0.31
423	0.35
424	0.34
425	0.34
426	0.33
427	0.28
428	0.24
429	0.22
430	0.22
431	0.19
432	0.19
433	0.23
434	0.25
435	0.24
436	0.23
437	0.22
438	0.21
439	0.22
440	0.27
441	0.3
442	0.3
443	0.35
444	0.4
445	0.47
446	0.55
447	0.56
448	0.57
449	0.51
450	0.56
451	0.55
452	0.55
453	0.53
454	0.47
455	0.45
456	0.39
457	0.38
458	0.3
459	0.26
460	0.22
461	0.17
462	0.19
463	0.2
464	0.19
465	0.2
466	0.2
467	0.19
468	0.19
469	0.16
470	0.12
471	0.1
472	0.1
473	0.08
474	0.07
475	0.07
476	0.08
477	0.09
478	0.1
479	0.12
480	0.14
481	0.15
482	0.19
483	0.22

A0A1D8PJG1

3D AlphaFold-predicted Structure Viewer