Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PJG1

Protein Details
Accession A0A1D8PJG1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-60QQSQAIQQKNKEKQQSRQKEQQEKHQQQQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002975  Fungi_Gprotein_alpha  
IPR001019  Gprotein_alpha_su  
IPR011025  GproteinA_insert  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005834  C:heterotrimeric G-protein complex  
GO:0001664  F:G protein-coupled receptor binding  
GO:0031683  F:G-protein beta/gamma-subunit complex binding  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007189  P:adenylate cyclase-activating G protein-coupled receptor signaling pathway  
GO:0030437  P:ascospore formation  
GO:0019933  P:cAMP-mediated signaling  
GO:0071333  P:cellular response to glucose stimulus  
GO:0036244  P:cellular response to neutral pH  
GO:0009267  P:cellular response to starvation  
GO:0030447  P:filamentous growth  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036168  P:filamentous growth of a population of unicellular organisms in response to heat  
GO:0036178  P:filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:0036170  P:filamentous growth of a population of unicellular organisms in response to starvation  
GO:0010255  P:glucose mediated signaling pathway  
GO:0006878  P:intracellular copper ion homeostasis  
GO:0001403  P:invasive growth in response to glucose limitation  
GO:0036165  P:invasive growth in response to heat  
GO:1900445  P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:1900433  P:positive regulation of filamentous growth of a population of unicellular organisms in response to heat  
GO:1900442  P:positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:1900436  P:positive regulation of filamentous growth of a population of unicellular organisms in response to starvation  
GO:0010737  P:protein kinase A signaling  
GO:0007124  P:pseudohyphal growth  
GO:0000749  P:response to pheromone triggering conjugation with cellular fusion  
GO:0001402  P:signal transduction involved in filamentous growth  
KEGG cal:CAALFM_C302240CA  -  
Pfam View protein in Pfam  
PF00503  G-alpha  
PROSITE View protein in PROSITE  
PS51882  G_ALPHA  
CDD cd00066  G-alpha  
Amino Acid Sequences MGSCASKSADQGNGTSKQQQSAQSTQGKRQQQSQAIQQKNKEKQQSRQKEQQEKHQQQQQQQPQPQSPSDSNADGTLKNGSDFYETLKHPSDSSNDNGHLKENHSQDLSNGTANKNLITNPVDAAGNSNPSKDVKVLLLGSGESGKSTIVKQMKILHSDGYTQDELEEYRPFVYKNILDCIKNVINAIIDLQPDLIRKPDSPQLEEDHEEDLKVTGLTSENNHVPTANGSVTNQPPPPPKQRKHILEYDMLNEILDYDYPLNLNQQFDPDIAIKIKKVYETPEVKEFMLQRQGDFYLIDSTDYFLSNLDRICLAGNYEPNVTDVLRTRKKTSGIFIYTFDLGNGLNMNLFDVGGQRSERKKWINCFDNVSTIIFCVALSEYDNFLLEESNTNRLEESLALFDSVVNSRWFSRTTVVLFLNKIDVFAEKLKYSPLENFFPDYKGGSNISNGVKYILWRFNKLNRSGLNIYPHVTQATDTSNIELVMAAVKQTILENSLKDSGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.39
4 0.37
5 0.4
6 0.44
7 0.45
8 0.46
9 0.52
10 0.54
11 0.56
12 0.6
13 0.64
14 0.65
15 0.61
16 0.64
17 0.65
18 0.64
19 0.66
20 0.68
21 0.7
22 0.71
23 0.74
24 0.74
25 0.74
26 0.75
27 0.78
28 0.78
29 0.75
30 0.76
31 0.81
32 0.85
33 0.83
34 0.84
35 0.85
36 0.85
37 0.83
38 0.84
39 0.84
40 0.81
41 0.81
42 0.79
43 0.75
44 0.73
45 0.79
46 0.78
47 0.77
48 0.75
49 0.74
50 0.72
51 0.71
52 0.65
53 0.61
54 0.52
55 0.47
56 0.44
57 0.38
58 0.33
59 0.31
60 0.3
61 0.24
62 0.23
63 0.21
64 0.18
65 0.16
66 0.16
67 0.14
68 0.15
69 0.15
70 0.18
71 0.21
72 0.22
73 0.26
74 0.29
75 0.29
76 0.27
77 0.29
78 0.29
79 0.26
80 0.3
81 0.31
82 0.31
83 0.33
84 0.33
85 0.34
86 0.33
87 0.32
88 0.34
89 0.31
90 0.31
91 0.29
92 0.29
93 0.26
94 0.28
95 0.26
96 0.23
97 0.22
98 0.19
99 0.21
100 0.21
101 0.21
102 0.18
103 0.17
104 0.18
105 0.18
106 0.18
107 0.15
108 0.17
109 0.16
110 0.14
111 0.18
112 0.14
113 0.18
114 0.17
115 0.17
116 0.17
117 0.18
118 0.19
119 0.17
120 0.17
121 0.12
122 0.15
123 0.15
124 0.14
125 0.14
126 0.12
127 0.12
128 0.12
129 0.1
130 0.07
131 0.07
132 0.06
133 0.07
134 0.08
135 0.14
136 0.17
137 0.18
138 0.21
139 0.29
140 0.33
141 0.35
142 0.36
143 0.31
144 0.27
145 0.29
146 0.27
147 0.24
148 0.2
149 0.17
150 0.16
151 0.14
152 0.14
153 0.13
154 0.13
155 0.09
156 0.1
157 0.11
158 0.11
159 0.11
160 0.15
161 0.16
162 0.17
163 0.23
164 0.25
165 0.24
166 0.24
167 0.3
168 0.27
169 0.25
170 0.22
171 0.17
172 0.14
173 0.14
174 0.15
175 0.1
176 0.09
177 0.08
178 0.09
179 0.09
180 0.09
181 0.1
182 0.1
183 0.1
184 0.1
185 0.14
186 0.19
187 0.2
188 0.22
189 0.24
190 0.26
191 0.28
192 0.29
193 0.27
194 0.23
195 0.2
196 0.18
197 0.16
198 0.13
199 0.09
200 0.08
201 0.06
202 0.05
203 0.05
204 0.06
205 0.07
206 0.1
207 0.11
208 0.13
209 0.13
210 0.12
211 0.12
212 0.12
213 0.13
214 0.1
215 0.09
216 0.09
217 0.13
218 0.14
219 0.17
220 0.17
221 0.18
222 0.23
223 0.27
224 0.38
225 0.44
226 0.46
227 0.52
228 0.6
229 0.63
230 0.64
231 0.66
232 0.58
233 0.53
234 0.5
235 0.43
236 0.35
237 0.29
238 0.23
239 0.16
240 0.12
241 0.08
242 0.06
243 0.05
244 0.04
245 0.04
246 0.05
247 0.05
248 0.07
249 0.09
250 0.1
251 0.09
252 0.1
253 0.11
254 0.11
255 0.12
256 0.11
257 0.11
258 0.11
259 0.11
260 0.11
261 0.12
262 0.13
263 0.12
264 0.12
265 0.15
266 0.22
267 0.26
268 0.28
269 0.31
270 0.32
271 0.31
272 0.33
273 0.3
274 0.25
275 0.28
276 0.25
277 0.21
278 0.21
279 0.21
280 0.19
281 0.18
282 0.15
283 0.1
284 0.1
285 0.11
286 0.09
287 0.09
288 0.09
289 0.1
290 0.09
291 0.07
292 0.07
293 0.08
294 0.08
295 0.08
296 0.07
297 0.07
298 0.08
299 0.08
300 0.08
301 0.09
302 0.11
303 0.12
304 0.12
305 0.12
306 0.12
307 0.13
308 0.11
309 0.11
310 0.14
311 0.22
312 0.28
313 0.31
314 0.34
315 0.38
316 0.42
317 0.43
318 0.43
319 0.43
320 0.41
321 0.4
322 0.38
323 0.36
324 0.32
325 0.3
326 0.24
327 0.16
328 0.11
329 0.09
330 0.08
331 0.06
332 0.05
333 0.05
334 0.06
335 0.05
336 0.05
337 0.05
338 0.06
339 0.07
340 0.08
341 0.09
342 0.14
343 0.18
344 0.22
345 0.28
346 0.35
347 0.41
348 0.48
349 0.57
350 0.59
351 0.58
352 0.62
353 0.57
354 0.53
355 0.47
356 0.4
357 0.3
358 0.23
359 0.2
360 0.13
361 0.11
362 0.08
363 0.07
364 0.06
365 0.08
366 0.09
367 0.09
368 0.1
369 0.1
370 0.09
371 0.09
372 0.09
373 0.08
374 0.12
375 0.13
376 0.19
377 0.19
378 0.19
379 0.19
380 0.19
381 0.19
382 0.15
383 0.15
384 0.11
385 0.11
386 0.11
387 0.11
388 0.11
389 0.12
390 0.12
391 0.12
392 0.11
393 0.12
394 0.13
395 0.16
396 0.17
397 0.17
398 0.19
399 0.21
400 0.22
401 0.26
402 0.28
403 0.29
404 0.28
405 0.27
406 0.29
407 0.24
408 0.22
409 0.17
410 0.15
411 0.16
412 0.19
413 0.21
414 0.17
415 0.18
416 0.2
417 0.21
418 0.22
419 0.26
420 0.27
421 0.29
422 0.31
423 0.35
424 0.34
425 0.34
426 0.33
427 0.28
428 0.24
429 0.22
430 0.22
431 0.19
432 0.19
433 0.23
434 0.25
435 0.24
436 0.23
437 0.22
438 0.21
439 0.22
440 0.27
441 0.3
442 0.3
443 0.35
444 0.4
445 0.47
446 0.55
447 0.56
448 0.57
449 0.51
450 0.56
451 0.55
452 0.55
453 0.53
454 0.47
455 0.45
456 0.39
457 0.38
458 0.3
459 0.26
460 0.22
461 0.17
462 0.19
463 0.2
464 0.19
465 0.2
466 0.2
467 0.19
468 0.19
469 0.16
470 0.12
471 0.1
472 0.1
473 0.08
474 0.07
475 0.07
476 0.08
477 0.09
478 0.1
479 0.12
480 0.14
481 0.15
482 0.19
483 0.22