Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SWX2

Protein Details
Accession M2SWX2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-73PSKVTRRMSKTKQAKKSKVKPFVKQHydrophilic
NLS Segment(s)
PositionSequence
57-66SKTKQAKKSK
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bsc:COCSADRAFT_169691  -  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKVGRVVIITRGRYAGKKCVIISPLDNGTKSHPFPHALVAGIETYPSKVTRRMSKTKQAKKSKVKPFVKQVNYTHIMPTRYTIELENLKGVISADTFKEVSQREEAKKTVKKAFEERYQSGKNRWFFTPLQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.37
5 0.38
6 0.37
7 0.39
8 0.39
9 0.42
10 0.41
11 0.39
12 0.36
13 0.32
14 0.33
15 0.31
16 0.3
17 0.25
18 0.28
19 0.31
20 0.3
21 0.28
22 0.25
23 0.25
24 0.26
25 0.29
26 0.25
27 0.2
28 0.19
29 0.17
30 0.15
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.09
37 0.09
38 0.13
39 0.17
40 0.26
41 0.34
42 0.42
43 0.47
44 0.57
45 0.66
46 0.71
47 0.77
48 0.79
49 0.81
50 0.82
51 0.86
52 0.86
53 0.86
54 0.82
55 0.78
56 0.78
57 0.77
58 0.72
59 0.68
60 0.6
61 0.57
62 0.54
63 0.49
64 0.42
65 0.36
66 0.32
67 0.25
68 0.25
69 0.21
70 0.18
71 0.18
72 0.16
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.14
79 0.14
80 0.13
81 0.09
82 0.07
83 0.08
84 0.07
85 0.1
86 0.1
87 0.1
88 0.15
89 0.15
90 0.17
91 0.23
92 0.29
93 0.31
94 0.35
95 0.38
96 0.43
97 0.48
98 0.52
99 0.53
100 0.52
101 0.54
102 0.58
103 0.64
104 0.64
105 0.66
106 0.64
107 0.65
108 0.66
109 0.65
110 0.64
111 0.63
112 0.6
113 0.55
114 0.53
115 0.5