Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QW60

Protein Details
Accession M2QW60    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
199-226RDRSSSRHHHHNHSRRHKPSKSHSYKSHBasic
284-304KGSSSRWKKRGQEGWDEKCRMHydrophilic
NLS Segment(s)
PositionSequence
213-216RRHK
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
KEGG bsc:COCSADRAFT_41204  -  
Amino Acid Sequences MAAQDYYLGTQCVHELPGSHPPNAYQSHSSKPPLYQQPPASPYMNTPPPSYSAHPHLPPPKQHNGYTPHQPYPEKPSQQQAMMAPYPQTPPPGGYFASPPPIPQPQPQLQRQHSSYLGAHLQPYRSHSQPARVRFEDQESDRSTSLGSISDSDSPPPPSRHHHHHYHHHYAQPTQRHITTQHSRPRDRTCDSDHSDRNRDRSSSRHHHHNHSRRHKPSKSHSYKSHEESHKTRDTFLGAGAGTIIGDVIFPGLGTAAGLVLGGYGGRKYALEKRRGDEGSDGEKGSSSRWKKRGQEGWDEKCRMGRKGAAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.26
5 0.29
6 0.28
7 0.27
8 0.28
9 0.34
10 0.35
11 0.36
12 0.33
13 0.34
14 0.4
15 0.45
16 0.48
17 0.45
18 0.45
19 0.5
20 0.53
21 0.54
22 0.56
23 0.56
24 0.6
25 0.6
26 0.61
27 0.53
28 0.44
29 0.42
30 0.43
31 0.43
32 0.37
33 0.35
34 0.32
35 0.34
36 0.38
37 0.37
38 0.34
39 0.34
40 0.39
41 0.39
42 0.45
43 0.5
44 0.52
45 0.57
46 0.59
47 0.62
48 0.61
49 0.61
50 0.61
51 0.59
52 0.58
53 0.6
54 0.58
55 0.53
56 0.52
57 0.52
58 0.47
59 0.5
60 0.54
61 0.49
62 0.46
63 0.49
64 0.48
65 0.47
66 0.47
67 0.4
68 0.37
69 0.32
70 0.31
71 0.24
72 0.22
73 0.23
74 0.2
75 0.2
76 0.14
77 0.15
78 0.17
79 0.18
80 0.17
81 0.16
82 0.18
83 0.18
84 0.22
85 0.2
86 0.18
87 0.19
88 0.24
89 0.25
90 0.26
91 0.32
92 0.35
93 0.42
94 0.48
95 0.54
96 0.52
97 0.57
98 0.55
99 0.51
100 0.44
101 0.4
102 0.34
103 0.28
104 0.26
105 0.2
106 0.2
107 0.18
108 0.19
109 0.17
110 0.21
111 0.22
112 0.21
113 0.25
114 0.24
115 0.32
116 0.37
117 0.42
118 0.45
119 0.43
120 0.44
121 0.41
122 0.44
123 0.4
124 0.36
125 0.34
126 0.3
127 0.3
128 0.28
129 0.26
130 0.22
131 0.16
132 0.15
133 0.1
134 0.08
135 0.07
136 0.08
137 0.1
138 0.11
139 0.12
140 0.13
141 0.15
142 0.17
143 0.19
144 0.2
145 0.24
146 0.29
147 0.36
148 0.4
149 0.47
150 0.51
151 0.59
152 0.65
153 0.68
154 0.66
155 0.61
156 0.57
157 0.51
158 0.5
159 0.45
160 0.41
161 0.34
162 0.31
163 0.29
164 0.3
165 0.34
166 0.36
167 0.38
168 0.43
169 0.48
170 0.5
171 0.54
172 0.6
173 0.58
174 0.54
175 0.51
176 0.5
177 0.51
178 0.53
179 0.56
180 0.55
181 0.55
182 0.6
183 0.57
184 0.56
185 0.51
186 0.47
187 0.41
188 0.41
189 0.45
190 0.47
191 0.49
192 0.54
193 0.56
194 0.64
195 0.73
196 0.76
197 0.77
198 0.77
199 0.82
200 0.82
201 0.87
202 0.83
203 0.81
204 0.83
205 0.83
206 0.82
207 0.81
208 0.8
209 0.78
210 0.78
211 0.74
212 0.74
213 0.68
214 0.66
215 0.62
216 0.61
217 0.62
218 0.55
219 0.51
220 0.43
221 0.39
222 0.32
223 0.28
224 0.22
225 0.14
226 0.13
227 0.12
228 0.1
229 0.07
230 0.06
231 0.06
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.02
248 0.03
249 0.03
250 0.03
251 0.03
252 0.04
253 0.04
254 0.05
255 0.09
256 0.19
257 0.27
258 0.36
259 0.41
260 0.44
261 0.53
262 0.54
263 0.52
264 0.48
265 0.46
266 0.44
267 0.42
268 0.39
269 0.3
270 0.3
271 0.28
272 0.26
273 0.3
274 0.32
275 0.39
276 0.46
277 0.55
278 0.62
279 0.72
280 0.78
281 0.75
282 0.79
283 0.79
284 0.81
285 0.82
286 0.77
287 0.68
288 0.66
289 0.64
290 0.56
291 0.51
292 0.47