Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RWF4

Protein Details
Accession M2RWF4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-70KARNLENKRRREERERLREMBasic
NLS Segment(s)
PositionSequence
52-65ARNLENKRRREERE
Subcellular Location(s) nucl 11, cyto 8, mito 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG bsc:COCSADRAFT_41259  -  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MYILFPISIMYYFGTNLDGKFTVPEFWPKPGQTHKIPYDRDEIAKELERIKARNLENKRRREERERLREMGGQTREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.12
5 0.12
6 0.11
7 0.13
8 0.13
9 0.13
10 0.13
11 0.2
12 0.19
13 0.23
14 0.27
15 0.26
16 0.3
17 0.35
18 0.39
19 0.36
20 0.42
21 0.45
22 0.48
23 0.48
24 0.46
25 0.44
26 0.4
27 0.37
28 0.3
29 0.25
30 0.21
31 0.22
32 0.21
33 0.18
34 0.22
35 0.23
36 0.23
37 0.24
38 0.29
39 0.3
40 0.38
41 0.45
42 0.51
43 0.58
44 0.66
45 0.71
46 0.72
47 0.77
48 0.77
49 0.79
50 0.79
51 0.81
52 0.79
53 0.74
54 0.69
55 0.66
56 0.61
57 0.59