Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2S7Z0

Protein Details
Accession M2S7Z0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEFRCKRYKEKKLRYFIETTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
KEGG bsc:COCSADRAFT_38214  -  
Amino Acid Sequences MEFRCKRYKEKKLRYFIETTTGRCASCIFVSTKYSLFVSKEEWEKVREEREERELAVARLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.65
4 0.63
5 0.54
6 0.46
7 0.42
8 0.38
9 0.31
10 0.27
11 0.27
12 0.19
13 0.17
14 0.17
15 0.12
16 0.13
17 0.15
18 0.16
19 0.15
20 0.14
21 0.15
22 0.14
23 0.13
24 0.12
25 0.14
26 0.17
27 0.2
28 0.22
29 0.23
30 0.23
31 0.25
32 0.28
33 0.31
34 0.34
35 0.34
36 0.36
37 0.4
38 0.41
39 0.38
40 0.4
41 0.37
42 0.32