Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2RZT6

Protein Details
Accession M2RZT6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPPHPMPICNNAKKKHRKPSSSTYYASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 13.165
Family & Domain DBs
KEGG bsc:COCSADRAFT_244167  -  
Amino Acid Sequences MPPHPMPICNNAKKKHRKPSSSTYYASEPHSSPKENKPPSHRPPCTALTFTHPNNPTIQDLLNPRFFSISTPQHSKAPQPSLPRIKYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.83
5 0.82
6 0.85
7 0.85
8 0.8
9 0.73
10 0.65
11 0.58
12 0.52
13 0.47
14 0.39
15 0.3
16 0.29
17 0.3
18 0.29
19 0.3
20 0.37
21 0.44
22 0.47
23 0.52
24 0.54
25 0.61
26 0.68
27 0.75
28 0.67
29 0.6
30 0.59
31 0.58
32 0.53
33 0.44
34 0.35
35 0.31
36 0.34
37 0.32
38 0.35
39 0.32
40 0.29
41 0.29
42 0.3
43 0.25
44 0.21
45 0.21
46 0.16
47 0.21
48 0.25
49 0.28
50 0.26
51 0.25
52 0.24
53 0.24
54 0.24
55 0.26
56 0.29
57 0.3
58 0.37
59 0.39
60 0.42
61 0.44
62 0.47
63 0.48
64 0.48
65 0.48
66 0.49
67 0.57
68 0.63