Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T0Z5

Protein Details
Accession M2T0Z5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MEPPSKQKAKNIPPRKTRIWQAPTPTPKILPRKREKKQNVTSTCNHydrophilic
NLS Segment(s)
PositionSequence
7-37QKAKNIPPRKTRIWQAPTPTPKILPRKREKK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG bsc:COCSADRAFT_33157  -  
Amino Acid Sequences MEPPSKQKAKNIPPRKTRIWQAPTPTPKILPRKREKKQNVTSTCNRKVKYLKHSPCPTTTVSATRRSQTHQHQSKEKKAKRFDIVHLTHRAYTYAMPCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.81
4 0.79
5 0.78
6 0.75
7 0.7
8 0.68
9 0.7
10 0.69
11 0.67
12 0.6
13 0.52
14 0.52
15 0.57
16 0.57
17 0.57
18 0.62
19 0.67
20 0.73
21 0.81
22 0.83
23 0.83
24 0.85
25 0.86
26 0.82
27 0.79
28 0.8
29 0.78
30 0.78
31 0.73
32 0.64
33 0.58
34 0.57
35 0.56
36 0.57
37 0.59
38 0.56
39 0.59
40 0.65
41 0.62
42 0.58
43 0.55
44 0.46
45 0.39
46 0.35
47 0.32
48 0.3
49 0.35
50 0.34
51 0.34
52 0.35
53 0.35
54 0.41
55 0.43
56 0.51
57 0.52
58 0.57
59 0.63
60 0.7
61 0.76
62 0.8
63 0.77
64 0.75
65 0.75
66 0.77
67 0.76
68 0.74
69 0.71
70 0.7
71 0.69
72 0.67
73 0.65
74 0.6
75 0.53
76 0.48
77 0.41
78 0.32
79 0.31