Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SNE8

Protein Details
Accession M2SNE8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-84MVSVGNRRLEPKRQRKRQRFSSVRHydrophilic
NLS Segment(s)
PositionSequence
68-79RLEPKRQRKRQR
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_275647  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MITTYKASQLPVFAIACKIESNLARKITIRASISKCPQQGAIFSTCYSGSIATPKRRQMIMVSVGNRRLEPKRQRKRQRFSSVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.14
5 0.13
6 0.13
7 0.16
8 0.19
9 0.23
10 0.24
11 0.24
12 0.25
13 0.27
14 0.26
15 0.28
16 0.26
17 0.28
18 0.31
19 0.36
20 0.39
21 0.42
22 0.4
23 0.35
24 0.35
25 0.29
26 0.26
27 0.22
28 0.2
29 0.16
30 0.15
31 0.15
32 0.13
33 0.13
34 0.12
35 0.09
36 0.07
37 0.13
38 0.19
39 0.26
40 0.31
41 0.34
42 0.38
43 0.38
44 0.38
45 0.35
46 0.36
47 0.35
48 0.37
49 0.36
50 0.36
51 0.4
52 0.4
53 0.37
54 0.35
55 0.33
56 0.37
57 0.45
58 0.52
59 0.6
60 0.7
61 0.81
62 0.87
63 0.93
64 0.94