Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2S5G6

Protein Details
Accession M2S5G6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-71AYQQGATRKKNKKQKYRHRRIYPIAPCFSHydrophilic
NLS Segment(s)
PositionSequence
50-62RKKNKKQKYRHRR
Subcellular Location(s) mito 16, plas 6, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_220323  -  
Amino Acid Sequences MSCIWTTQKLCYIQQKGMLFYMASALFASLQLVLVTHLTGRLAYQQGATRKKNKKQKYRHRRIYPIAPCFSHRTIREKEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.42
4 0.39
5 0.35
6 0.25
7 0.2
8 0.2
9 0.13
10 0.11
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.06
29 0.07
30 0.07
31 0.09
32 0.13
33 0.2
34 0.27
35 0.31
36 0.39
37 0.47
38 0.56
39 0.65
40 0.71
41 0.75
42 0.79
43 0.86
44 0.88
45 0.91
46 0.93
47 0.93
48 0.92
49 0.9
50 0.89
51 0.87
52 0.84
53 0.78
54 0.69
55 0.62
56 0.59
57 0.55
58 0.53
59 0.47
60 0.46