Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T3V4

Protein Details
Accession M2T3V4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
35-57LIPVHCSRRSRKENQRRISPVLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, extr 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_206119  -  
Amino Acid Sequences MITPHILGCLPCLTTKAASYASPPPSTYTNPREALIPVHCSRRSRKENQRRISPVLKHRPKIAILAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.15
6 0.18
7 0.24
8 0.26
9 0.25
10 0.25
11 0.24
12 0.26
13 0.29
14 0.32
15 0.3
16 0.33
17 0.33
18 0.32
19 0.31
20 0.29
21 0.28
22 0.23
23 0.24
24 0.2
25 0.24
26 0.26
27 0.28
28 0.34
29 0.41
30 0.47
31 0.52
32 0.61
33 0.67
34 0.75
35 0.81
36 0.85
37 0.81
38 0.8
39 0.79
40 0.76
41 0.76
42 0.77
43 0.77
44 0.7
45 0.7
46 0.68
47 0.61