Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CUF6

Protein Details
Accession B0CUF6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-31STISAPRRVPKGRRIRKLPPTKVRNARTVRHydrophilic
60-84VILFWKRIKEPKRPRHSRRFSFIPPHydrophilic
NLS Segment(s)
PositionSequence
7-31PRRVPKGRRIRKLPPTKVRNARTVR
65-78KRIKEPKRPRHSRR
Subcellular Location(s) mito 15.5, mito_nucl 12.333, nucl 8, cyto_nucl 6.333
Family & Domain DBs
KEGG lbc:LACBIDRAFT_305516  -  
Amino Acid Sequences MSTISAPRRVPKGRRIRKLPPTKVRNARTVRPRATSTSSREPLTNSSNATTLHKTFVRRVILFWKRIKEPKRPRHSRRFSFIPPGFVTVDPAQFTKSARRRAIYVNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.82
4 0.85
5 0.89
6 0.89
7 0.88
8 0.86
9 0.86
10 0.87
11 0.82
12 0.81
13 0.76
14 0.73
15 0.73
16 0.74
17 0.68
18 0.63
19 0.61
20 0.56
21 0.56
22 0.54
23 0.51
24 0.51
25 0.49
26 0.45
27 0.43
28 0.4
29 0.37
30 0.35
31 0.3
32 0.21
33 0.19
34 0.2
35 0.2
36 0.21
37 0.2
38 0.16
39 0.18
40 0.19
41 0.19
42 0.2
43 0.25
44 0.27
45 0.25
46 0.26
47 0.33
48 0.36
49 0.41
50 0.43
51 0.41
52 0.42
53 0.49
54 0.53
55 0.55
56 0.6
57 0.65
58 0.72
59 0.78
60 0.82
61 0.86
62 0.91
63 0.88
64 0.85
65 0.82
66 0.76
67 0.76
68 0.69
69 0.64
70 0.54
71 0.49
72 0.43
73 0.35
74 0.35
75 0.26
76 0.26
77 0.21
78 0.21
79 0.19
80 0.18
81 0.2
82 0.26
83 0.32
84 0.39
85 0.43
86 0.46
87 0.48