Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SS36

Protein Details
Accession M2SS36    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
159-184LEGQGTQATKPKRKKPWEKDDVPVEAHydrophilic
NLS Segment(s)
PositionSequence
169-173PKRKK
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
KEGG bsc:COCSADRAFT_184508  -  
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSVTTDGLDDVYEALERYNWDDDVEFQAGLQAIVGSNSTPEQTTELALRARCFYYARKYNKNIDFDAYKAYRNARNRPPPSPPSSTNVLASSVIDQELPSTTTSATTPATTTEPSGTLPSPPTATEPPAPYPTSFAHIVELITSGKPVPGIKEIPPTVLEGQGTQATKPKRKKPWEKDDVPVEAAKEASSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.09
4 0.12
5 0.14
6 0.14
7 0.15
8 0.15
9 0.17
10 0.21
11 0.21
12 0.17
13 0.14
14 0.16
15 0.15
16 0.14
17 0.12
18 0.07
19 0.06
20 0.06
21 0.07
22 0.05
23 0.05
24 0.06
25 0.07
26 0.07
27 0.08
28 0.09
29 0.1
30 0.11
31 0.12
32 0.14
33 0.16
34 0.17
35 0.18
36 0.18
37 0.18
38 0.18
39 0.19
40 0.21
41 0.28
42 0.36
43 0.42
44 0.49
45 0.53
46 0.61
47 0.66
48 0.66
49 0.57
50 0.52
51 0.46
52 0.38
53 0.39
54 0.31
55 0.25
56 0.23
57 0.25
58 0.27
59 0.32
60 0.4
61 0.42
62 0.52
63 0.55
64 0.57
65 0.61
66 0.61
67 0.61
68 0.59
69 0.51
70 0.45
71 0.45
72 0.42
73 0.36
74 0.3
75 0.25
76 0.19
77 0.17
78 0.14
79 0.09
80 0.08
81 0.07
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.08
92 0.08
93 0.07
94 0.07
95 0.08
96 0.1
97 0.1
98 0.1
99 0.1
100 0.1
101 0.1
102 0.12
103 0.11
104 0.1
105 0.11
106 0.12
107 0.12
108 0.11
109 0.14
110 0.14
111 0.17
112 0.19
113 0.21
114 0.23
115 0.26
116 0.27
117 0.23
118 0.25
119 0.23
120 0.23
121 0.22
122 0.19
123 0.17
124 0.16
125 0.16
126 0.12
127 0.13
128 0.1
129 0.09
130 0.09
131 0.07
132 0.07
133 0.09
134 0.09
135 0.1
136 0.14
137 0.17
138 0.19
139 0.27
140 0.28
141 0.28
142 0.28
143 0.29
144 0.26
145 0.25
146 0.23
147 0.15
148 0.17
149 0.19
150 0.19
151 0.16
152 0.22
153 0.28
154 0.36
155 0.45
156 0.53
157 0.59
158 0.7
159 0.81
160 0.85
161 0.89
162 0.91
163 0.87
164 0.86
165 0.83
166 0.77
167 0.68
168 0.59
169 0.49
170 0.39
171 0.33