Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D3A2

Protein Details
Accession B0D3A2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-69GMPPMPPKGSKKKSVKSPSERARKVTHydrophilic
NLS Segment(s)
PositionSequence
40-67RKKLGMPPMPPKGSKKKSVKSPSERARK
Subcellular Location(s) plas 10extr 10, E.R. 4, mito 1, pero 1, golg 1
Family & Domain DBs
KEGG lbc:LACBIDRAFT_324860  -  
Amino Acid Sequences MKVLLFVALLALTLLALTTSILADDDQEYTPPEIVRNEQRKKLGMPPMPPKGSKKKSVKSPSERARKVTGPLAGGLGMAPFKVSKQTAIGHIAIHKGNVNGAVLGFLDNHKIVKSAEQAPKYAYILTGPLSEIRVLVRMHRFHAMWRADGSVLGRARRVFVSKPGDRPLQDHKGATHFETSVFSIDPDTHEIDIQWVNPDGSLPPVHIVLMDERIFYVGDVMAFRDYTDAVVTPVTTFLNDSWALGLWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.1
13 0.1
14 0.1
15 0.13
16 0.13
17 0.16
18 0.15
19 0.16
20 0.16
21 0.21
22 0.31
23 0.39
24 0.45
25 0.49
26 0.53
27 0.55
28 0.56
29 0.59
30 0.58
31 0.54
32 0.55
33 0.58
34 0.63
35 0.64
36 0.63
37 0.63
38 0.64
39 0.64
40 0.66
41 0.67
42 0.66
43 0.73
44 0.8
45 0.83
46 0.81
47 0.85
48 0.85
49 0.86
50 0.81
51 0.75
52 0.7
53 0.62
54 0.56
55 0.5
56 0.43
57 0.33
58 0.3
59 0.26
60 0.21
61 0.18
62 0.14
63 0.09
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.08
70 0.08
71 0.09
72 0.12
73 0.14
74 0.17
75 0.2
76 0.21
77 0.18
78 0.19
79 0.21
80 0.18
81 0.17
82 0.15
83 0.11
84 0.11
85 0.11
86 0.09
87 0.07
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.09
101 0.13
102 0.2
103 0.25
104 0.26
105 0.27
106 0.27
107 0.28
108 0.26
109 0.22
110 0.14
111 0.09
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.09
122 0.09
123 0.12
124 0.17
125 0.18
126 0.19
127 0.22
128 0.22
129 0.2
130 0.29
131 0.26
132 0.22
133 0.22
134 0.21
135 0.18
136 0.19
137 0.18
138 0.15
139 0.16
140 0.15
141 0.16
142 0.15
143 0.17
144 0.17
145 0.2
146 0.15
147 0.22
148 0.3
149 0.32
150 0.37
151 0.4
152 0.43
153 0.41
154 0.43
155 0.43
156 0.42
157 0.41
158 0.37
159 0.34
160 0.34
161 0.35
162 0.33
163 0.27
164 0.19
165 0.18
166 0.18
167 0.17
168 0.14
169 0.13
170 0.12
171 0.1
172 0.1
173 0.11
174 0.13
175 0.14
176 0.13
177 0.13
178 0.13
179 0.15
180 0.15
181 0.14
182 0.13
183 0.12
184 0.12
185 0.12
186 0.12
187 0.1
188 0.12
189 0.12
190 0.1
191 0.1
192 0.11
193 0.11
194 0.1
195 0.11
196 0.1
197 0.15
198 0.15
199 0.14
200 0.14
201 0.14
202 0.14
203 0.13
204 0.12
205 0.07
206 0.08
207 0.08
208 0.09
209 0.1
210 0.1
211 0.1
212 0.1
213 0.09
214 0.09
215 0.1
216 0.09
217 0.09
218 0.09
219 0.1
220 0.09
221 0.1
222 0.1
223 0.09
224 0.1
225 0.1
226 0.14
227 0.14
228 0.13
229 0.13