Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RDG2

Protein Details
Accession M2RDG2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
112-141ALTRHTSKEPRRHAGRRTRRIPCRHPSIPTBasic
NLS Segment(s)
PositionSequence
119-136KEPRRHAGRRTRRIPCRH
Subcellular Location(s) mito 21, cyto 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001471  AP2/ERF_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
KEGG bsc:COCSADRAFT_315442  -  
PROSITE View protein in PROSITE  
PS51032  AP2_ERF  
Amino Acid Sequences MMGVSVRECQWVSVGKWSGRMQKGRSGQSRAEPRVALAPDAAQPIAARAFDSATEGLVSVAAQAWTCLVRLPFLDCHGHGCGVLAPTLFSAPPSPYPSLSGIPPCSTTRSHALTRHTSKEPRRHAGRRTRRIPCRHPSIPTARHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.37
4 0.41
5 0.47
6 0.49
7 0.54
8 0.48
9 0.52
10 0.58
11 0.61
12 0.63
13 0.6
14 0.56
15 0.59
16 0.65
17 0.6
18 0.56
19 0.47
20 0.41
21 0.41
22 0.38
23 0.3
24 0.21
25 0.18
26 0.16
27 0.17
28 0.16
29 0.1
30 0.09
31 0.1
32 0.1
33 0.09
34 0.07
35 0.06
36 0.07
37 0.07
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.06
58 0.08
59 0.09
60 0.11
61 0.12
62 0.11
63 0.14
64 0.14
65 0.14
66 0.11
67 0.11
68 0.1
69 0.09
70 0.1
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.1
80 0.14
81 0.15
82 0.16
83 0.18
84 0.2
85 0.21
86 0.21
87 0.22
88 0.2
89 0.2
90 0.23
91 0.21
92 0.22
93 0.22
94 0.23
95 0.25
96 0.28
97 0.32
98 0.34
99 0.39
100 0.46
101 0.51
102 0.53
103 0.54
104 0.58
105 0.62
106 0.67
107 0.7
108 0.7
109 0.74
110 0.75
111 0.79
112 0.81
113 0.84
114 0.85
115 0.86
116 0.86
117 0.86
118 0.89
119 0.88
120 0.87
121 0.85
122 0.81
123 0.76
124 0.74
125 0.75