Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T2I4

Protein Details
Accession M2T2I4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-43AKSKNSSQHNQSKKNHRNGIKKPKTHHydrophilic
NLS Segment(s)
PositionSequence
30-78KKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKR
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bsc:COCSADRAFT_80195  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences ALRQYHTAKSTSTTVAMAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.26
4 0.23
5 0.22
6 0.24
7 0.26
8 0.31
9 0.36
10 0.37
11 0.42
12 0.51
13 0.58
14 0.63
15 0.68
16 0.73
17 0.76
18 0.8
19 0.8
20 0.79
21 0.79
22 0.8
23 0.84
24 0.82
25 0.8
26 0.78
27 0.8
28 0.79
29 0.75
30 0.75
31 0.72
32 0.7
33 0.69
34 0.68
35 0.64
36 0.62
37 0.6
38 0.61
39 0.56
40 0.59
41 0.61
42 0.63
43 0.67
44 0.68
45 0.75
46 0.68
47 0.73
48 0.68
49 0.68
50 0.65
51 0.61
52 0.57
53 0.52
54 0.49
55 0.42
56 0.4
57 0.32
58 0.33
59 0.36
60 0.39
61 0.42