Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T1L4

Protein Details
Accession M2T1L4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
105-126LRWIKFKWFKTGPAKERKKVHKBasic
NLS Segment(s)
PositionSequence
61-69RGQGRRKMK
109-126KFKWFKTGPAKERKKVHK
Subcellular Location(s) extr 10, plas 8, E.R. 4, mito 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_359063  -  
Amino Acid Sequences MHLLATLLVTLPFVASVSAWTNLVPTCQTPPAHWGRNGNCAPVDRDRCITNTAICRLFGKRGQGRRKMKKMMVNGNDSVLDNFACIQRGRRRMEGVIVGVRMRDLRWIKFKWFKTGPAKERKKVHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.06
4 0.09
5 0.1
6 0.1
7 0.1
8 0.11
9 0.11
10 0.12
11 0.12
12 0.11
13 0.13
14 0.18
15 0.18
16 0.18
17 0.25
18 0.32
19 0.36
20 0.37
21 0.41
22 0.39
23 0.48
24 0.48
25 0.43
26 0.37
27 0.33
28 0.34
29 0.34
30 0.36
31 0.28
32 0.29
33 0.28
34 0.28
35 0.29
36 0.26
37 0.22
38 0.22
39 0.24
40 0.23
41 0.22
42 0.22
43 0.21
44 0.23
45 0.21
46 0.25
47 0.28
48 0.36
49 0.44
50 0.52
51 0.61
52 0.68
53 0.73
54 0.72
55 0.72
56 0.69
57 0.69
58 0.69
59 0.64
60 0.59
61 0.51
62 0.45
63 0.41
64 0.34
65 0.27
66 0.17
67 0.12
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.15
74 0.22
75 0.3
76 0.35
77 0.38
78 0.41
79 0.4
80 0.44
81 0.4
82 0.36
83 0.32
84 0.28
85 0.24
86 0.21
87 0.2
88 0.17
89 0.13
90 0.18
91 0.19
92 0.24
93 0.32
94 0.36
95 0.44
96 0.53
97 0.56
98 0.57
99 0.58
100 0.61
101 0.64
102 0.71
103 0.72
104 0.74
105 0.8
106 0.78