Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SVZ0

Protein Details
Accession M2SVZ0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-41AEPPKKRKSKSSMQKRIDHVBasic
NLS Segment(s)
PositionSequence
21-32PAEPPKKRKSKS
Subcellular Location(s) mito 10, plas 8, cyto 4, nucl 2, E.R. 2
Family & Domain DBs
KEGG bsc:COCSADRAFT_239830  -  
Amino Acid Sequences MHPHPNTRTYIRTHIRDARSPAEPPKKRKSKSSMQKRIDHVICRFAHVTLVCLLVFPRVRSRAYVRCLVARSEGACIAMWVISLYYCPLHLPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.62
4 0.62
5 0.56
6 0.51
7 0.5
8 0.52
9 0.54
10 0.56
11 0.57
12 0.63
13 0.68
14 0.68
15 0.74
16 0.72
17 0.72
18 0.75
19 0.79
20 0.79
21 0.76
22 0.81
23 0.75
24 0.76
25 0.69
26 0.63
27 0.53
28 0.5
29 0.43
30 0.38
31 0.35
32 0.26
33 0.24
34 0.19
35 0.18
36 0.11
37 0.12
38 0.09
39 0.09
40 0.09
41 0.1
42 0.11
43 0.11
44 0.16
45 0.18
46 0.18
47 0.22
48 0.28
49 0.32
50 0.35
51 0.41
52 0.37
53 0.39
54 0.4
55 0.38
56 0.35
57 0.29
58 0.26
59 0.22
60 0.2
61 0.17
62 0.15
63 0.14
64 0.11
65 0.09
66 0.08
67 0.06
68 0.06
69 0.05
70 0.05
71 0.07
72 0.07
73 0.07