Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SV44

Protein Details
Accession M2SV44   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-90NKGAPKKNKATPYKNKNKSSAHydrophilic
NLS Segment(s)
PositionSequence
74-78PKKNK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_34731  -  
Amino Acid Sequences MAMRSRTDSILQNAPKPAGRTDTACKRMIERLEKQFKKDIARMKEAKTSNGQTTNKRKNKNDNEEENGINKGAPKKNKATPYKNKNKSSADNELMIKEEIPEEEIPEYITQSLDSALMDGGFLGNFFSCRGLISPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.34
5 0.3
6 0.3
7 0.3
8 0.36
9 0.44
10 0.46
11 0.47
12 0.46
13 0.43
14 0.47
15 0.5
16 0.49
17 0.47
18 0.52
19 0.6
20 0.61
21 0.62
22 0.63
23 0.6
24 0.58
25 0.55
26 0.54
27 0.49
28 0.56
29 0.56
30 0.52
31 0.55
32 0.5
33 0.48
34 0.45
35 0.42
36 0.37
37 0.42
38 0.42
39 0.43
40 0.52
41 0.6
42 0.61
43 0.65
44 0.66
45 0.69
46 0.76
47 0.78
48 0.76
49 0.72
50 0.7
51 0.65
52 0.61
53 0.51
54 0.41
55 0.3
56 0.22
57 0.17
58 0.18
59 0.2
60 0.23
61 0.26
62 0.31
63 0.37
64 0.46
65 0.53
66 0.57
67 0.63
68 0.7
69 0.77
70 0.81
71 0.8
72 0.78
73 0.75
74 0.72
75 0.69
76 0.66
77 0.57
78 0.51
79 0.47
80 0.4
81 0.36
82 0.29
83 0.22
84 0.14
85 0.12
86 0.09
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.09
96 0.09
97 0.07
98 0.07
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.06
114 0.07
115 0.07
116 0.09
117 0.1