Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SSC3

Protein Details
Accession M2SSC3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
12-37GRTAGGRRLLQRRGRKARRRAGEGREBasic
NLS Segment(s)
PositionSequence
9-43GRHGRTAGGRRLLQRRGRKARRRAGEGREGGGGRR
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG bsc:COCSADRAFT_253230  -  
Amino Acid Sequences MLAVLWERGRHGRTAGGRRLLQRRGRKARRRAGEGREGGGGRREVLIGRGWWRGVAWCRRLLWQLETETAMRSAARREGAGTDNEQRRRRAAARAATATEATAGPRAAKAACGREQAAGQGVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.5
4 0.52
5 0.57
6 0.64
7 0.65
8 0.65
9 0.66
10 0.7
11 0.74
12 0.81
13 0.84
14 0.86
15 0.88
16 0.87
17 0.86
18 0.83
19 0.79
20 0.78
21 0.7
22 0.61
23 0.55
24 0.46
25 0.38
26 0.33
27 0.26
28 0.17
29 0.15
30 0.14
31 0.1
32 0.11
33 0.12
34 0.1
35 0.13
36 0.13
37 0.13
38 0.13
39 0.13
40 0.15
41 0.19
42 0.24
43 0.24
44 0.26
45 0.27
46 0.29
47 0.31
48 0.29
49 0.25
50 0.22
51 0.21
52 0.18
53 0.19
54 0.17
55 0.16
56 0.14
57 0.12
58 0.09
59 0.08
60 0.09
61 0.1
62 0.11
63 0.1
64 0.11
65 0.13
66 0.15
67 0.16
68 0.18
69 0.23
70 0.29
71 0.37
72 0.4
73 0.39
74 0.4
75 0.44
76 0.44
77 0.44
78 0.45
79 0.45
80 0.48
81 0.49
82 0.49
83 0.44
84 0.41
85 0.33
86 0.26
87 0.18
88 0.13
89 0.11
90 0.1
91 0.1
92 0.1
93 0.11
94 0.1
95 0.14
96 0.18
97 0.23
98 0.27
99 0.31
100 0.31
101 0.32
102 0.33
103 0.31
104 0.29