Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SNE5

Protein Details
Accession M2SNE5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-74RRTHMHPSKGKKRKRATTKPDQDDSBasic
NLS Segment(s)
PositionSequence
55-65HPSKGKKRKRA
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
KEGG bsc:COCSADRAFT_71739  -  
Amino Acid Sequences MAPTAKQNTKPVFKTASPFTETQWPELSHDDELVVLEMLSNLIAPLGDHRRTHMHPSKGKKRKRATTKPDQDDSTTETPPPPPPIGNHLLIGLNSVTRHLEALAAKTAPSTTLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.47
4 0.43
5 0.41
6 0.37
7 0.41
8 0.39
9 0.36
10 0.35
11 0.31
12 0.29
13 0.32
14 0.31
15 0.22
16 0.22
17 0.18
18 0.14
19 0.13
20 0.11
21 0.08
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.02
30 0.02
31 0.02
32 0.06
33 0.12
34 0.14
35 0.14
36 0.17
37 0.22
38 0.24
39 0.33
40 0.36
41 0.39
42 0.43
43 0.53
44 0.62
45 0.66
46 0.71
47 0.72
48 0.74
49 0.75
50 0.8
51 0.82
52 0.8
53 0.82
54 0.86
55 0.83
56 0.78
57 0.7
58 0.61
59 0.52
60 0.49
61 0.41
62 0.31
63 0.25
64 0.21
65 0.22
66 0.23
67 0.25
68 0.21
69 0.19
70 0.2
71 0.26
72 0.3
73 0.29
74 0.27
75 0.24
76 0.23
77 0.21
78 0.21
79 0.15
80 0.11
81 0.1
82 0.1
83 0.1
84 0.09
85 0.1
86 0.09
87 0.12
88 0.12
89 0.15
90 0.18
91 0.17
92 0.17
93 0.17
94 0.17
95 0.14